Q9HS14 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS14 - Phosphate-specific transport system accessory protein PhoU

UniProt:	Q9HS14	Sequences: MSEVVTDRLRMALEAMAQKDDDAAWEVIDGDDEINQLYLDLEDDCIDLLALQQPVAGDLRLIASSFKIITDLERIGDLAANLAEYTLDADRDMFPEVDVQAIGDRTIEMVTDAMAAYASADVEACYAIAERDDDIDERCRSASQTVIRDLIETEIDAATDDAEIEALMQDVSRLLLTVRDLERVGDHAVNISARTVYMVDNDDELIY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	207 (191)
Sequences:	4350 (3325)
Seq/√Len:	240.6

ECOLI - PHOU YJBB
HALSA - Q9HS14 Q9HS09

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_D	131_R	3.328	1.00
14_E	18_Q	3.004	1.00
2_S	114_M	2.894	1.00
115_A	119_S	2.629	1.00
6_T	111_T	2.601	1.00
34_I	76_G	2.550	1.00
11_M	26_E	2.508	1.00
128_I	192_S	2.301	1.00
136_D	186_D	2.293	1.00
35_N	77_D	2.237	1.00
135_I	185_G	2.221	1.00
71_D	190_N	2.203	1.00
13_L	103_G	2.176	1.00
73_E	77_D	2.154	1.00
5_V	72_L	2.153	1.00
11_M	30_G	2.081	1.00
132_D	136_D	2.056	1.00
31_D	77_D	1.977	1.00
105_R	134_D	1.960	1.00
112_D	127_A	1.934	1.00
8_R	34_I	1.910	1.00
10_R	107_I	1.902	1.00
71_D	187_H	1.873	1.00
17_A	100_Q	1.800	1.00
14_E	23_A	1.778	1.00
25_W	87_L	1.775	1.00
112_D	124_A	1.760	1.00
11_M	23_A	1.729	1.00
148_R	152_E	1.701	1.00
31_D	73_E	1.679	1.00
108_E	112_D	1.678	1.00
25_W	29_D	1.671	1.00
68_I	191_I	1.664	1.00
106_T	135_I	1.662	1.00
35_N	73_E	1.645	1.00
131_R	134_D	1.645	1.00
136_D	182_E	1.636	1.00
5_V	34_I	1.581	1.00
64_S	198_M	1.555	1.00
65_S	117_Y	1.533	1.00
115_A	124_A	1.461	1.00
75_I	184_V	1.438	1.00
12_A	79_A	1.409	1.00
3_E	6_T	1.406	1.00
81_N	180_D	1.383	1.00
113_A	188_A	1.351	1.00
9_L	184_V	1.346	1.00
106_T	181_L	1.343	1.00
12_A	86_T	1.338	1.00
75_I	110_V	1.338	1.00
6_T	10_R	1.336	1.00
121_D	124_A	1.330	1.00
132_D	182_E	1.327	1.00
21_D	90_D	1.324	1.00
98_D	145_T	1.322	1.00
36_Q	40_D	1.308	1.00
45_C	62_I	1.306	1.00
82_L	177_T	1.295	1.00
47_D	51_L	1.295	1.00
123_E	126_Y	1.279	1.00
31_D	80_A	1.269	1.00
182_E	186_D	1.266	1.00
110_V	188_A	1.266	1.00
113_A	195_T	1.260	1.00
109_M	185_G	1.259	1.00
28_I	31_D	1.254	1.00
48_L	62_I	1.248	1.00
108_E	131_R	1.242	1.00
127_A	131_R	1.235	1.00
150_L	168_M	1.224	1.00
134_D	137_E	1.222	1.00
124_A	127_A	1.222	1.00
31_D	35_N	1.209	1.00
30_G	33_E	1.150	1.00
122_V	199_V	1.137	1.00
132_D	186_D	1.133	1.00
119_S	124_A	1.127	1.00
7_D	11_M	1.117	1.00
45_C	69_I	1.108	1.00
40_D	44_D	1.107	1.00
88_D	173_R	1.105	1.00
125_C	196_V	1.099	1.00
139_C	178_V	1.096	1.00
98_D	141_S	1.084	1.00
105_R	108_E	1.079	1.00
20_D	23_A	1.073	1.00
61_L	120_A	1.071	1.00
15_A	27_V	1.057	1.00
115_A	118_A	1.032	1.00
145_T	149_D	1.032	1.00
8_R	30_G	1.031	1.00
21_D	87_L	1.030	1.00
106_T	188_A	1.027	1.00
190_N	193_A	1.022	1.00
85_Y	173_R	1.020	1.00
45_C	66_F	1.015	1.00
105_R	131_R	1.014	1.00
133_D	136_D	1.009	1.00
126_Y	196_V	1.008	1.00
46_I	197_Y	1.008	1.00
6_T	107_I	1.006	1.00
109_M	135_I	1.003	1.00
148_R	151_I	0.997	1.00
26_E	30_G	0.993	1.00
122_V	196_V	0.990	1.00
38_Y	67_K	0.989	1.00
15_A	86_T	0.986	1.00
97_V	100_Q	0.983	1.00
74_R	183_R	0.978	1.00
5_V	75_I	0.972	1.00
105_R	135_I	0.962	1.00
8_R	27_V	0.960	1.00
22_D	25_W	0.956	1.00
116_A	128_I	0.947	1.00
102_I	139_C	0.944	1.00
24_A	87_L	0.927	1.00
104_D	108_E	0.925	1.00
21_D	25_W	0.923	1.00
149_D	152_E	0.918	1.00
107_I	111_T	0.916	1.00
15_A	24_A	0.912	1.00
19_K	89_A	0.909	1.00
142_A	178_V	0.907	1.00
10_R	111_T	0.904	1.00
63_A	66_F	0.902	1.00
50_A	59_L	0.898	1.00
28_I	87_L	0.898	1.00
5_V	76_G	0.895	1.00
4_V	33_E	0.890	1.00
27_V	83_A	0.889	1.00
32_D	35_N	0.882	0.99
101_A	134_D	0.879	0.99
92_D	95_P	0.878	0.99
150_L	153_T	0.875	0.99
46_I	63_A	0.872	0.99
149_D	153_T	0.870	0.99
144_Q	148_R	0.868	0.99
111_T	115_A	0.858	0.99
101_A	104_D	0.855	0.99
27_V	30_G	0.845	0.99
23_A	26_E	0.845	0.99
67_K	70_T	0.839	0.99
116_A	125_C	0.836	0.99
152_E	155_I	0.831	0.99
102_I	181_L	0.831	0.99
38_Y	69_I	0.827	0.99
121_D	125_C	0.825	0.99
11_M	14_E	0.816	0.99
101_A	138_R	0.808	0.99
84_E	140_R	0.804	0.99
9_L	79_A	0.803	0.99
20_D	24_A	0.801	0.99
142_A	145_T	0.800	0.99
4_V	34_I	0.800	0.99
28_I	83_A	0.799	0.99
24_A	83_A	0.799	0.99
3_E	118_A	0.797	0.99
65_S	68_I	0.796	0.99
74_R	190_N	0.793	0.99
3_E	115_A	0.793	0.99
86_T	177_T	0.789	0.99
150_L	154_E	0.785	0.99
13_L	181_L	0.784	0.99
44_D	47_D	0.782	0.99
4_V	37_L	0.781	0.99
33_E	36_Q	0.775	0.99
136_D	185_G	0.774	0.99
138_R	141_S	0.769	0.99
42_E	67_K	0.768	0.99
105_R	138_R	0.767	0.99
67_K	194_R	0.766	0.99
41_L	70_T	0.764	0.99
42_E	194_R	0.756	0.98
73_E	190_N	0.756	0.98
172_S	175_L	0.753	0.98
147_I	151_I	0.745	0.98
85_Y	177_T	0.743	0.98
97_V	101_A	0.741	0.98
182_E	185_G	0.741	0.98
126_Y	200_D	0.735	0.98
168_M	171_V	0.731	0.98
69_I	194_R	0.725	0.98
15_A	23_A	0.723	0.98
126_Y	130_E	0.720	0.98
188_A	195_T	0.716	0.98
48_L	52_Q	0.712	0.98
78_L	184_V	0.709	0.98
19_K	90_D	0.705	0.97
26_E	29_D	0.701	0.97
71_D	194_R	0.699	0.97
102_I	138_R	0.699	0.97
89_A	170_D	0.698	0.97
56_A	59_L	0.696	0.97
137_E	141_S	0.692	0.97
179_R	187_H	0.691	0.97
75_I	188_A	0.691	0.97
78_L	180_D	0.683	0.97
133_D	189_V	0.683	0.97
146_V	171_V	0.682	0.97
189_V	193_A	0.679	0.97
98_D	101_A	0.676	0.97
103_G	181_L	0.672	0.97
128_I	131_R	0.671	0.97
24_A	31_D	0.666	0.96
112_D	115_A	0.666	0.96
18_Q	23_A	0.665	0.96
8_R	12_A	0.662	0.96
32_D	36_Q	0.661	0.96
61_L	198_M	0.659	0.96
52_Q	55_V	0.653	0.96
143_S	147_I	0.651	0.96
151_I	168_M	0.650	0.96
79_A	184_V	0.647	0.96
6_T	118_A	0.646	0.96
106_T	184_V	0.645	0.96
71_D	78_L	0.640	0.96
45_C	49_L	0.638	0.95
109_M	132_D	0.638	0.95
104_D	107_I	0.637	0.95
23_A	27_V	0.636	0.95
42_E	45_C	0.635	0.95
1_M	38_Y	0.634	0.95
109_M	188_A	0.632	0.95
28_I	80_A	0.630	0.95
81_N	84_E	0.627	0.95
13_L	17_A	0.625	0.95
78_L	139_C	0.623	0.95
93_M	96_E	0.622	0.95
39_L	42_E	0.622	0.95
101_A	105_R	0.620	0.95
94_F	97_V	0.620	0.95
77_D	190_N	0.609	0.94
10_R	14_E	0.607	0.94
98_D	149_D	0.602	0.94
132_D	185_G	0.598	0.94
66_F	69_I	0.598	0.94
139_C	179_R	0.588	0.93
16_M	177_T	0.587	0.93
176_L	179_R	0.584	0.93
95_P	146_V	0.584	0.93
78_L	187_H	0.580	0.93
45_C	194_R	0.580	0.93
122_V	126_Y	0.578	0.93
95_P	174_L	0.575	0.92
78_L	179_R	0.572	0.92
24_A	28_I	0.572	0.92
7_D	10_R	0.571	0.92
15_A	83_A	0.571	0.92
8_R	79_A	0.571	0.92
68_I	194_R	0.569	0.92
15_A	19_K	0.567	0.92
41_L	69_I	0.564	0.92
153_T	156_D	0.563	0.92
120_A	199_V	0.554	0.91
113_A	192_S	0.553	0.91
15_A	20_D	0.552	0.91
8_R	76_G	0.550	0.91
85_Y	180_D	0.547	0.90
148_R	156_D	0.545	0.90
17_A	96_E	0.544	0.90
95_P	149_D	0.543	0.90
100_Q	104_D	0.543	0.90
73_E	76_G	0.541	0.90
185_G	193_A	0.537	0.90
148_R	153_T	0.536	0.89
103_G	106_T	0.535	0.89
5_V	79_A	0.534	0.89
81_N	189_V	0.533	0.89
110_V	113_A	0.528	0.89
148_R	154_E	0.528	0.89
113_A	191_I	0.524	0.88
38_Y	42_E	0.524	0.88
54_P	59_L	0.523	0.88
152_E	156_D	0.523	0.88
109_M	131_R	0.521	0.88
81_N	85_Y	0.520	0.88
41_L	72_L	0.512	0.87
37_L	40_D	0.510	0.87
19_K	91_R	0.507	0.87
149_D	155_I	0.506	0.87
108_E	134_D	0.506	0.87
72_L	110_V	0.503	0.86
120_A	198_M	0.502	0.86
85_Y	88_D	0.502	0.86
145_T	148_R	0.502	0.86
194_R	198_M	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1sumB	2	0.9469	100	0.157	Contact Map
2i0mA	2	0.9179	100	0.168	Contact Map
1xwmA	2	0.942	100	0.17	Contact Map
4q25A	2	0.9227	100	0.181	Contact Map
1t72A	5	0.9227	100	0.205	Contact Map
2oltA	5	0.8792	100	0.421	Contact Map
3l39A	3	0.8744	99.6	0.637	Contact Map
1vctA	3	0.8599	97.2	0.836	Contact Map
3ci9A	5	0.2029	11.9	0.941	Contact Map
3oq3A	1	0.5411	9.8	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.