Q9HS06 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HS06 - Uncharacterized protein

UniProt:	Q9HS06	Sequences: MDLDKLVHQPTRLELFAYLYRHGESSFGDLTDELDLTEGNLSSHLQRMEDADAVEVRKEFVDKRPHTTAVLTEDGEAMFEDHVQTLQGLIDGLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	94 (89)
Sequences:	911 (631)
Seq/√Len:	66.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_L	56_V	3.259	1.00
45_L	69_A	3.231	1.00
55_E	70_V	2.909	1.00
53_A	78_M	2.658	1.00
11_T	36_L	2.539	1.00
16_F	71_L	2.280	1.00
31_T	38_E	2.201	1.00
26_S	29_D	2.069	1.00
52_D	74_D	2.041	1.00
60_F	65_P	1.990	1.00
22_H	25_S	1.911	1.00
24_E	57_R	1.822	1.00
58_K	67_T	1.800	1.00
36_L	40_N	1.783	1.00
60_F	63_K	1.741	1.00
4_D	81_D	1.669	0.99
46_Q	63_K	1.666	0.99
87_Q	91_D	1.596	0.99
49_E	63_K	1.589	0.99
77_A	81_D	1.549	0.99
59_E	68_T	1.527	0.99
37_T	40_N	1.493	0.99
4_D	53_A	1.429	0.98
18_Y	25_S	1.375	0.98
17_A	79_F	1.320	0.97
6_L	51_A	1.311	0.97
8_H	82_H	1.311	0.97
18_Y	33_E	1.310	0.97
7_V	16_F	1.274	0.96
6_L	47_R	1.260	0.96
9_Q	44_H	1.258	0.96
30_L	45_L	1.255	0.96
24_E	68_T	1.246	0.96
20_Y	71_L	1.204	0.95
16_F	53_A	1.148	0.93
39_G	43_S	1.135	0.93
10_P	14_E	1.128	0.93
4_D	74_D	1.121	0.93
18_Y	30_L	1.118	0.92
82_H	85_T	1.116	0.92
46_Q	50_D	1.104	0.92
61_V	66_H	1.094	0.92
4_D	78_M	1.054	0.90
26_S	66_H	1.046	0.90
64_R	68_T	1.008	0.88
43_S	82_H	0.998	0.87
83_V	90_I	0.968	0.86
18_Y	29_D	0.967	0.86
14_E	34_L	0.967	0.86
5_K	47_R	0.947	0.85
59_E	66_H	0.942	0.84
34_L	89_L	0.937	0.84
13_L	79_F	0.896	0.81
44_H	85_T	0.888	0.81
24_E	55_E	0.860	0.78
85_T	88_G	0.857	0.78
39_G	47_R	0.845	0.77
3_L	86_L	0.840	0.77
79_F	83_V	0.833	0.76
54_V	91_D	0.832	0.76
43_S	47_R	0.827	0.76
20_Y	79_F	0.823	0.75
7_V	79_F	0.822	0.75
61_V	64_R	0.806	0.74
7_V	53_A	0.805	0.74
25_S	29_D	0.805	0.74
73_E	81_D	0.804	0.74
40_N	43_S	0.801	0.73
44_H	89_L	0.796	0.73
3_L	82_H	0.789	0.72
14_E	25_S	0.786	0.72
49_E	65_P	0.770	0.70
40_N	47_R	0.761	0.69
45_L	55_E	0.753	0.69
5_K	11_T	0.743	0.68
28_G	31_T	0.736	0.67
82_H	90_I	0.730	0.66
46_Q	86_L	0.729	0.66
31_T	79_F	0.728	0.66
36_L	43_S	0.727	0.66
27_F	38_E	0.726	0.66
32_D	38_E	0.721	0.65
11_T	44_H	0.715	0.65
16_F	48_M	0.708	0.64
7_V	78_M	0.703	0.63
56_V	69_A	0.701	0.63
11_T	34_L	0.701	0.63
60_F	64_R	0.699	0.63
74_D	84_Q	0.694	0.62
48_M	78_M	0.680	0.61
4_D	8_H	0.671	0.60
24_E	70_V	0.662	0.59
15_L	34_L	0.655	0.58
7_V	82_H	0.651	0.57
5_K	10_P	0.646	0.57
73_E	91_D	0.638	0.56
61_V	65_P	0.637	0.56
82_H	86_L	0.633	0.55
29_D	83_V	0.632	0.55
12_R	15_L	0.621	0.54
7_V	44_H	0.619	0.54
60_F	68_T	0.607	0.52
56_V	65_P	0.589	0.50
10_P	33_E	0.573	0.48
46_Q	49_E	0.573	0.48
79_F	90_I	0.571	0.48
13_L	28_G	0.568	0.48
74_D	78_M	0.562	0.47
21_R	47_R	0.561	0.47
4_D	7_V	0.556	0.46
57_R	68_T	0.554	0.46
37_T	47_R	0.549	0.45
16_F	82_H	0.546	0.45
84_Q	88_G	0.545	0.45
74_D	77_A	0.541	0.44
29_D	33_E	0.539	0.44
17_A	90_I	0.538	0.44
45_L	63_K	0.537	0.44
71_L	82_H	0.532	0.43
50_D	77_A	0.532	0.43
22_H	33_E	0.531	0.43
15_L	69_A	0.527	0.43
21_R	54_V	0.527	0.43
56_V	63_K	0.524	0.42
15_L	41_L	0.524	0.42
45_L	54_V	0.520	0.42
10_P	38_E	0.519	0.42
63_K	89_L	0.519	0.42
23_G	76_E	0.517	0.42
8_H	51_A	0.514	0.41
18_Y	80_E	0.512	0.41
28_G	39_G	0.511	0.41
28_G	83_V	0.507	0.40
5_K	73_E	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3u1dA	2	1	99.2	0.644	Contact Map
3elkA	3	0.9787	99.2	0.647	Contact Map
2eshA	2	0.9894	99.2	0.652	Contact Map
1xmaA	2	0.9681	99.2	0.652	Contact Map
3hhhA	2	0.9787	99.2	0.653	Contact Map
4ejoA	2	0.9787	99.2	0.656	Contact Map
2zfwA	2	0.9681	99.1	0.663	Contact Map
2e1nA	2	0.9681	99.1	0.665	Contact Map
3f8bA	2	0.9574	99.1	0.668	Contact Map
1ub9A	2	0.9894	99.1	0.67	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.