Q9HRZ8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRZ8 - Uncharacterized protein

UniProt:	Q9HRZ8	Sequences: MRNHVRERRGEADLSQADLAAAVGVTRQTINAIERDRYDPSIELAFKLADFFDCRIEDLFDPELDG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	66 (60)
Sequences:	1869 (1220)
Seq/√Len:	157.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_A	21_A	2.719	1.00
46_F	62_P	2.527	1.00
4_H	7_E	2.434	1.00
22_A	51_F	2.393	1.00
9_R	34_E	2.052	1.00
55_R	58_D	1.897	1.00
14_L	51_F	1.814	1.00
46_F	56_I	1.777	1.00
8_R	59_L	1.546	1.00
8_R	54_C	1.525	1.00
7_E	10_G	1.522	1.00
6_R	10_G	1.510	1.00
54_C	58_D	1.501	1.00
15_S	18_D	1.433	1.00
18_D	22_A	1.429	1.00
7_E	13_D	1.406	1.00
23_V	51_F	1.333	1.00
48_L	59_L	1.292	1.00
25_V	30_I	1.276	1.00
7_E	11_E	1.263	1.00
49_A	56_I	1.253	1.00
31_N	35_R	1.228	1.00
43_E	47_K	1.220	1.00
45_A	56_I	1.190	1.00
12_A	53_D	1.182	1.00
4_H	61_D	1.169	1.00
19_L	30_I	1.164	1.00
29_T	38_Y	1.163	1.00
33_I	38_Y	1.127	1.00
50_D	62_P	1.104	1.00
39_D	42_I	1.100	0.99
43_E	62_P	1.029	0.99
8_R	11_E	1.009	0.99
54_C	59_L	0.970	0.99
10_G	13_D	0.958	0.99
23_V	52_F	0.951	0.99
4_H	8_R	0.945	0.98
14_L	18_D	0.929	0.98
28_Q	32_A	0.924	0.98
14_L	22_A	0.919	0.98
12_A	22_A	0.916	0.98
23_V	30_I	0.887	0.98
6_R	13_D	0.879	0.98
39_D	43_E	0.864	0.97
39_D	62_P	0.856	0.97
27_R	60_F	0.851	0.97
37_R	42_I	0.850	0.97
18_D	21_A	0.847	0.97
38_Y	44_L	0.822	0.96
16_Q	30_I	0.815	0.96
19_L	52_F	0.811	0.96
16_Q	27_R	0.800	0.96
47_K	62_P	0.794	0.96
17_A	27_R	0.782	0.95
25_V	29_T	0.780	0.95
4_H	11_E	0.750	0.94
26_T	32_A	0.748	0.94
41_S	44_L	0.742	0.94
48_L	54_C	0.730	0.93
25_V	33_I	0.727	0.93
8_R	12_A	0.712	0.92
3_N	45_A	0.690	0.91
15_S	31_N	0.688	0.91
11_E	54_C	0.684	0.91
33_I	42_I	0.677	0.90
47_K	50_D	0.653	0.88
5_V	61_D	0.652	0.88
23_V	44_L	0.650	0.88
4_H	22_A	0.645	0.88
4_H	55_R	0.604	0.84
33_I	44_L	0.599	0.84
55_R	61_D	0.578	0.82
44_L	47_K	0.575	0.81
46_F	50_D	0.572	0.81
5_V	48_L	0.568	0.80
40_P	44_L	0.567	0.80
19_L	51_F	0.566	0.80
3_N	28_Q	0.561	0.80
5_V	10_G	0.560	0.79
3_N	60_F	0.560	0.79
45_A	60_F	0.550	0.78
5_V	62_P	0.540	0.77
5_V	19_L	0.535	0.76
41_S	52_F	0.522	0.75
38_Y	60_F	0.518	0.74
6_R	35_R	0.514	0.73
12_A	52_F	0.510	0.73
6_R	32_A	0.510	0.73
6_R	15_S	0.508	0.73
19_L	23_V	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y9qA	1	1	99.5	0.255	Contact Map
3u3wA	2	0.9848	99.5	0.259	Contact Map
4yarA	2	1	99.5	0.26	Contact Map
2p5tA	2	0.0606	99.5	0.261	Contact Map
3tysA	2	0.9697	99.5	0.273	Contact Map
4o8bA	2	1	99.5	0.274	Contact Map
4ichA	2	0	99.5	0.274	Contact Map
4ndwA	2	1	99.4	0.276	Contact Map
3mlfA	2	1	99.4	0.279	Contact Map
3ivpA	2	1	99.4	0.281	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.