Q9HRZ4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRZ4 - Uncharacterized protein

UniProt:	Q9HRZ4	Sequences: MDETPVTVQAVDDVGPDAIAVTFETPAGFTAEPGQFVRVVREFEDGETEGRYYTLSSPTVADTFEVTVDVAPDGVLGPWLAGRDPGDEVTVEGPFGEDYYQGEPSVLLLAGGPGVGPAVAIAERAMDAGAEVALVYQDEAPVHEPRLAALSDAGADVLVVTDAFEDAVATLADASDQAAFVYGFAAFCGAATDALEAEGFDTDAVKVESFGPEP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	214 (199)
Sequences:	19172 (13496)
Seq/√Len:	956.7

ECOLI - FRE PAAE HCR YEAX FENR HMP
BACSU - HMP PYRK
HALSA - Q9HRZ4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_S	131_E	3.442	1.00
22_T	63_T	2.821	1.00
9_Q	24_E	2.773	1.00
84_D	87_D	2.654	1.00
14_V	20_A	2.592	1.00
11_V	19_I	2.552	1.00
20_A	65_E	2.543	1.00
144_E	148_A	2.475	1.00
124_R	128_A	2.472	1.00
7_T	88_E	2.442	1.00
7_T	24_E	2.375	1.00
22_T	65_E	2.310	1.00
123_E	146_R	2.286	1.00
10_A	22_T	2.235	1.00
8_V	83_R	2.185	1.00
13_D	19_I	2.185	1.00
38_R	52_Y	2.101	1.00
110_A	118_A	2.085	1.00
111_G	184_F	2.073	1.00
6_V	91_V	2.031	1.00
56_S	67_T	1.992	1.00
40_V	90_T	1.988	1.00
107_L	179_A	1.968	1.00
164_F	167_A	1.881	1.00
12_D	20_A	1.870	1.00
37_V	66_V	1.847	1.00
179_A	195_L	1.825	1.00
10_A	85_P	1.751	1.00
110_A	136_Y	1.669	1.00
21_V	80_L	1.633	1.00
133_A	158_L	1.619	1.00
149_A	153_A	1.612	1.00
115_V	134_L	1.603	1.00
9_Q	63_T	1.554	1.00
105_S	133_A	1.531	1.00
23_F	66_V	1.529	1.00
179_A	200_F	1.526	1.00
192_T	196_E	1.524	1.00
138_D	141_P	1.512	1.00
137_Q	187_F	1.502	1.00
181_V	191_A	1.478	1.00
24_E	63_T	1.476	1.00
35_Q	96_G	1.472	1.00
105_S	177_Q	1.468	1.00
109_L	187_F	1.462	1.00
6_V	23_F	1.455	1.00
104_P	178_A	1.423	1.00
111_G	187_F	1.419	1.00
133_A	160_V	1.404	1.00
196_E	202_T	1.397	1.00
141_P	144_E	1.373	1.00
166_D	169_A	1.359	1.00
70_V	78_P	1.349	1.00
141_P	163_A	1.349	1.00
167_A	170_T	1.340	1.00
37_V	91_V	1.339	1.00
8_V	23_F	1.310	1.00
165_E	169_A	1.290	1.00
12_D	22_T	1.285	1.00
70_V	81_A	1.283	1.00
143_H	146_R	1.268	1.00
109_L	191_A	1.268	1.00
108_L	118_A	1.263	1.00
104_P	176_D	1.263	1.00
160_V	163_A	1.259	1.00
11_V	21_V	1.258	1.00
167_A	171_L	1.254	1.00
148_A	151_S	1.252	1.00
164_F	168_V	1.249	1.00
119_V	123_E	1.243	1.00
157_V	162_D	1.242	1.00
181_V	188_C	1.218	1.00
185_A	189_G	1.207	1.00
165_E	197_A	1.190	1.00
193_D	197_A	1.186	1.00
19_I	81_A	1.174	1.00
119_V	146_R	1.169	1.00
181_V	205_V	1.162	1.00
20_A	67_T	1.147	1.00
168_V	171_L	1.131	1.00
8_V	21_V	1.121	1.00
20_A	143_H	1.114	1.00
38_R	92_E	1.107	1.00
37_V	55_L	1.106	1.00
18_A	113_P	1.101	1.00
164_F	171_L	1.098	1.00
186_A	190_A	1.096	1.00
158_L	163_A	1.093	1.00
126_M	153_A	1.085	1.00
67_T	142_V	1.080	1.00
194_A	197_A	1.073	1.00
11_V	84_D	1.072	1.00
11_V	85_P	1.065	1.00
6_V	25_T	1.060	1.00
7_T	26_P	1.059	1.00
110_A	134_L	1.058	1.00
58_P	123_E	1.038	1.00
108_L	121_I	1.032	1.00
157_V	163_A	1.031	1.00
67_T	143_H	1.022	1.00
126_M	154_G	1.022	1.00
146_R	149_A	1.017	1.00
40_V	50_G	1.016	1.00
118_A	134_L	1.002	1.00
178_A	204_A	1.000	1.00
166_D	171_L	0.999	1.00
158_L	162_D	0.998	1.00
17_D	140_A	0.991	1.00
113_P	116_G	0.988	1.00
71_A	74_G	0.987	1.00
43_F	79_W	0.978	1.00
79_W	82_G	0.975	1.00
60_V	127_D	0.972	1.00
83_R	87_D	0.970	1.00
26_P	88_E	0.968	1.00
107_L	177_Q	0.967	1.00
131_E	158_L	0.965	1.00
17_D	69_D	0.963	1.00
125_A	132_V	0.961	1.00
149_A	152_D	0.938	1.00
189_G	193_D	0.934	1.00
122_A	132_V	0.934	1.00
108_L	122_A	0.927	1.00
39_V	66_V	0.921	1.00
192_T	205_V	0.916	1.00
190_A	193_D	0.906	1.00
159_V	163_A	0.896	1.00
74_G	77_G	0.894	1.00
28_G	64_F	0.894	1.00
108_L	132_V	0.891	1.00
190_A	194_A	0.891	1.00
151_S	155_A	0.888	1.00
100_Y	121_I	0.874	1.00
33_P	124_R	0.874	1.00
145_P	149_A	0.874	1.00
32_E	99_Y	0.870	1.00
201_D	204_A	0.862	1.00
151_S	154_G	0.859	1.00
156_D	162_D	0.859	1.00
173_D	177_Q	0.855	1.00
111_G	186_A	0.848	1.00
8_V	11_V	0.837	1.00
145_P	148_A	0.829	1.00
57_S	65_E	0.824	1.00
119_V	143_H	0.822	1.00
80_L	83_R	0.820	1.00
96_G	99_Y	0.815	1.00
53_Y	77_G	0.814	1.00
154_G	157_V	0.805	1.00
156_D	163_A	0.804	1.00
100_Y	106_V	0.801	1.00
9_Q	22_T	0.800	1.00
68_V	80_L	0.798	1.00
49_E	75_V	0.797	1.00
148_A	152_D	0.792	1.00
49_E	76_L	0.791	1.00
166_D	170_T	0.791	1.00
115_V	147_L	0.784	1.00
194_A	198_E	0.784	1.00
24_E	62_D	0.776	1.00
31_A	120_A	0.776	1.00
122_A	147_L	0.773	1.00
57_S	123_E	0.769	1.00
16_P	140_A	0.769	1.00
152_D	155_A	0.768	1.00
148_A	161_T	0.763	1.00
141_P	161_T	0.761	1.00
61_A	123_E	0.760	1.00
151_S	159_V	0.755	1.00
104_P	130_A	0.755	1.00
67_T	116_G	0.754	1.00
23_F	89_V	0.751	1.00
14_V	67_T	0.751	1.00
15_G	140_A	0.750	1.00
106_V	130_A	0.749	1.00
136_Y	142_V	0.749	1.00
35_Q	99_Y	0.748	1.00
25_T	28_G	0.746	1.00
58_P	127_D	0.744	1.00
174_A	177_Q	0.739	1.00
111_G	190_A	0.737	1.00
131_E	156_D	0.737	1.00
17_D	72_P	0.736	1.00
157_V	161_T	0.733	1.00
106_V	132_V	0.732	1.00
169_A	198_E	0.720	1.00
92_E	95_F	0.717	1.00
6_V	26_P	0.717	1.00
43_F	46_G	0.713	1.00
32_E	35_Q	0.712	1.00
191_A	194_A	0.711	1.00
137_Q	162_D	0.709	1.00
18_A	142_V	0.707	1.00
72_P	78_P	0.706	1.00
109_L	135_V	0.704	1.00
122_A	134_L	0.702	1.00
42_E	48_T	0.701	1.00
56_S	65_E	0.700	1.00
50_G	92_E	0.698	1.00
108_L	180_F	0.698	1.00
106_V	125_A	0.696	1.00
13_D	16_P	0.696	1.00
57_S	61_A	0.694	1.00
158_L	161_T	0.690	1.00
176_D	204_A	0.689	1.00
38_R	50_G	0.689	1.00
165_E	168_V	0.689	1.00
60_V	124_R	0.688	1.00
6_V	64_F	0.687	1.00
102_G	130_A	0.682	1.00
147_L	159_V	0.679	1.00
126_M	150_L	0.678	1.00
41_R	76_L	0.677	1.00
173_D	176_D	0.676	1.00
189_G	192_T	0.674	1.00
156_D	161_T	0.672	1.00
138_D	161_T	0.672	1.00
31_A	57_S	0.669	1.00
103_E	106_V	0.668	1.00
39_V	80_L	0.665	1.00
100_Y	125_A	0.661	1.00
134_L	157_V	0.660	1.00
33_P	59_T	0.658	1.00
59_T	124_R	0.658	1.00
124_R	127_D	0.655	1.00
36_F	52_Y	0.654	1.00
115_V	136_Y	0.652	1.00
31_A	55_L	0.651	1.00
181_V	195_L	0.648	1.00
18_A	67_T	0.648	1.00
105_S	130_A	0.645	1.00
151_S	157_V	0.645	1.00
6_V	28_G	0.641	1.00
64_F	91_V	0.640	1.00
61_A	127_D	0.638	1.00
76_L	80_L	0.627	1.00
146_R	150_L	0.627	1.00
126_M	132_V	0.625	1.00
104_P	204_A	0.625	1.00
47_E	75_V	0.620	1.00
58_P	61_A	0.620	1.00
31_A	58_P	0.619	1.00
121_I	180_F	0.615	1.00
144_E	159_V	0.612	1.00
193_D	196_E	0.610	1.00
109_L	179_A	0.608	1.00
31_A	59_T	0.606	1.00
55_L	64_F	0.606	1.00
159_V	162_D	0.605	1.00
156_D	160_V	0.604	1.00
77_G	81_A	0.603	1.00
106_V	178_A	0.603	1.00
73_D	78_P	0.601	1.00
51_R	74_G	0.587	1.00
17_D	139_E	0.585	1.00
51_R	76_L	0.582	1.00
54_T	118_A	0.571	1.00
102_G	178_A	0.570	1.00
164_F	169_A	0.569	1.00
165_E	170_T	0.566	1.00
37_V	64_F	0.565	1.00
107_L	133_A	0.565	1.00
125_A	128_A	0.563	1.00
79_W	83_R	0.562	1.00
181_V	192_T	0.562	1.00
200_F	205_V	0.560	1.00
40_V	92_E	0.559	1.00
119_V	147_L	0.557	1.00
29_F	93_G	0.556	1.00
43_F	47_E	0.556	1.00
40_V	48_T	0.553	1.00
25_T	29_F	0.552	1.00
21_V	81_A	0.550	1.00
6_V	89_V	0.544	1.00
42_E	46_G	0.538	1.00
68_V	77_G	0.536	1.00
143_H	147_L	0.533	1.00
147_L	150_L	0.532	1.00
144_E	161_T	0.530	1.00
173_D	200_F	0.530	1.00
141_P	148_A	0.529	1.00
150_L	153_A	0.528	1.00
125_A	129_G	0.526	1.00
133_A	177_Q	0.525	1.00
126_M	157_V	0.524	1.00
43_F	48_T	0.523	1.00
164_F	170_T	0.520	1.00
157_V	160_V	0.520	1.00
179_A	205_V	0.516	1.00
38_R	95_F	0.516	1.00
148_A	159_V	0.515	1.00
115_V	143_H	0.513	1.00
122_A	150_L	0.510	1.00
34_G	96_G	0.508	1.00
195_L	205_V	0.507	1.00
25_T	64_F	0.505	1.00
83_R	89_V	0.502	1.00
186_A	189_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gvhA	3	0.9953	100	0.192	Contact Map
1cqxA	2	0.9953	100	0.204	Contact Map
4g1vA	3	0.9953	100	0.221	Contact Map
1krhA	1	0.9813	100	0.227	Contact Map
4p6vF	1	0.9907	100	0.228	Contact Map
1tvcA	1	0.986	100	0.23	Contact Map
2r6hA	1	0.986	100	0.233	Contact Map
1qfjA	1	0.9439	100	0.236	Contact Map
4u9uA	1	0.9907	100	0.241	Contact Map
3jqqA	2	0.9673	100	0.247	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.