Q9HRW5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRW5 - Uncharacterized protein

UniProt:	Q9HRW5	Sequences: MSATETADALESLPPSAKLVAKVLEYNDTLSQRELAEKTLLPDRTVRYALTRLEDHDIVSSRFSFTDARKRLYTLT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	76 (70)
Sequences:	163 (88)
Seq/√Len:	10.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_K	25_E	3.803	0.99
22_K	26_Y	2.999	0.94
40_L	70_K	2.542	0.86
64_S	72_L	2.187	0.76
61_S	64_S	2.128	0.74
17_A	30_L	2.061	0.72
20_V	23_V	1.937	0.67
7_A	10_L	1.936	0.67
33_R	70_K	1.931	0.66
59_V	74_T	1.685	0.55
55_D	59_V	1.608	0.52
54_E	61_S	1.550	0.49
46_V	49_A	1.534	0.48
47_R	68_A	1.531	0.48
17_A	20_V	1.458	0.45
21_A	70_K	1.405	0.42
13_L	51_T	1.390	0.42
10_L	58_I	1.346	0.40
52_R	65_F	1.331	0.39
35_L	40_L	1.308	0.38
34_E	40_L	1.278	0.37
23_V	68_A	1.237	0.35
31_S	43_D	1.226	0.34
42_P	62_R	1.208	0.34
19_L	32_Q	1.192	0.33
48_Y	62_R	1.168	0.32
42_P	75_L	1.157	0.32
21_A	61_S	1.132	0.31
43_D	48_Y	1.093	0.29
35_L	43_D	1.088	0.29
8_D	27_N	1.088	0.29
43_D	50_L	1.088	0.29
35_L	50_L	1.073	0.28
32_Q	68_A	1.068	0.28
49_A	65_F	1.043	0.27
11_E	52_R	1.041	0.27
29_T	39_T	1.038	0.27
21_A	71_R	1.031	0.27
38_K	75_L	0.992	0.25
49_A	64_S	0.977	0.25
8_D	74_T	0.972	0.25
10_L	55_D	0.931	0.23
23_V	28_D	0.927	0.23
38_K	58_I	0.922	0.23
56_H	62_R	0.910	0.22
12_S	38_K	0.904	0.22
59_V	71_R	0.891	0.22
42_P	72_L	0.887	0.22
15_P	18_K	0.880	0.21
38_K	60_S	0.877	0.21
40_L	59_V	0.871	0.21
7_A	21_A	0.864	0.21
36_A	50_L	0.832	0.20
47_R	73_Y	0.831	0.20
50_L	59_V	0.815	0.19
16_S	19_L	0.790	0.19
17_A	56_H	0.783	0.19
63_F	71_R	0.770	0.18
8_D	29_T	0.769	0.18
37_E	51_T	0.764	0.18
17_A	49_A	0.761	0.18
33_R	74_T	0.761	0.18
26_Y	36_A	0.755	0.18
54_E	59_V	0.750	0.18
55_D	62_R	0.728	0.17
11_E	57_D	0.726	0.17
35_L	57_D	0.718	0.17
29_T	34_E	0.718	0.17
52_R	72_L	0.710	0.17
54_E	60_S	0.708	0.17
29_T	66_T	0.694	0.16
15_P	19_L	0.691	0.16
7_A	58_I	0.684	0.16
57_D	60_S	0.684	0.16
38_K	48_Y	0.674	0.16
8_D	48_Y	0.672	0.16
30_L	37_E	0.671	0.16
8_D	60_S	0.648	0.15
49_A	68_A	0.643	0.15
39_T	46_V	0.642	0.15
9_A	58_I	0.640	0.15
10_L	29_T	0.636	0.15
42_P	54_E	0.635	0.15
20_V	49_A	0.616	0.14
20_V	68_A	0.609	0.14
29_T	63_F	0.569	0.13
7_A	33_R	0.566	0.13
27_N	75_L	0.562	0.13
11_E	61_S	0.560	0.13
27_N	72_L	0.554	0.13
23_V	26_Y	0.552	0.13
12_S	29_T	0.548	0.13
18_K	47_R	0.547	0.13
33_R	36_A	0.546	0.13
54_E	58_I	0.541	0.13
61_S	65_F	0.540	0.13
49_A	61_S	0.536	0.13
21_A	63_F	0.534	0.12
64_S	74_T	0.531	0.12
8_D	43_D	0.523	0.12
27_N	59_V	0.521	0.12
31_S	70_K	0.514	0.12
21_A	62_R	0.504	0.12
20_V	52_R	0.502	0.12
23_V	35_L	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dk5A	1	1	98.7	0.675	Contact Map
2mlgA	1	0.8684	98.3	0.709	Contact Map
3nqoA	2	0.9868	98.3	0.713	Contact Map
1hsjA	2	1	98.3	0.716	Contact Map
3bddA	2	0.9737	98.2	0.72	Contact Map
2nnnA	2	0.9342	98.2	0.721	Contact Map
2fxaA	4	1	98.2	0.721	Contact Map
3zplA	2	1	98.2	0.722	Contact Map
4rbrA	2	0.9474	98.2	0.722	Contact Map
3cdhA	4	0.8947	98.2	0.722	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.