Q9HRU6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRU6 - Uncharacterized protein

UniProt:	Q9HRU6	Sequences: MNRTRIVVVAASVLAVLTVIAAVVPAGTVLVADDTDTDQRYLTVPVSEGSTVALEYTHSVERSRVYEAYAVRGETLEMTRAEFESYGWGFPSAANVTIENGTFVYSPDRTATVLTVSPGRIAGHTLHVDDRSYDLVSVTDAQSVDLHVVHRTLLATMIESIYE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	163 (145)
Sequences:	322 (289)
Seq/√Len:	24.0

HALSA - Q9HRU6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_S	85_S	3.967	1.00
56_Y	65_V	3.964	1.00
61_E	88_W	3.008	1.00
52_V	76_L	3.000	1.00
65_V	90_F	2.617	0.99
57_T	64_R	2.616	0.99
56_Y	90_F	2.510	0.99
60_V	85_S	2.301	0.97
119_G	124_H	2.243	0.97
84_E	102_T	2.237	0.97
63_S	84_E	2.189	0.97
86_Y	103_F	2.092	0.96
65_V	103_F	1.984	0.94
60_V	81_A	1.932	0.93
68_A	80_R	1.856	0.92
14_L	21_A	1.821	0.91
50_S	129_D	1.806	0.91
61_E	65_V	1.772	0.90
115_T	145_D	1.767	0.90
83_F	96_V	1.759	0.89
55_E	66_Y	1.730	0.88
60_V	90_F	1.718	0.88
82_E	102_T	1.714	0.88
56_Y	83_F	1.660	0.86
60_V	87_G	1.648	0.86
81_A	87_G	1.581	0.83
126_L	144_V	1.576	0.83
61_E	67_E	1.570	0.83
116_V	146_L	1.569	0.83
80_R	104_V	1.550	0.82
65_V	119_G	1.543	0.82
63_S	90_F	1.484	0.79
80_R	106_S	1.478	0.79
61_E	96_V	1.469	0.79
14_L	19_V	1.435	0.77
72_R	77_E	1.410	0.76
45_P	126_L	1.397	0.75
65_V	116_V	1.323	0.71
24_V	114_L	1.316	0.70
46_V	50_S	1.295	0.69
32_A	153_L	1.269	0.67
51_T	99_E	1.267	0.67
88_W	120_R	1.264	0.67
96_V	103_F	1.246	0.66
57_T	119_G	1.229	0.65
117_S	143_S	1.224	0.65
49_G	71_V	1.219	0.64
65_V	91_P	1.217	0.64
21_A	32_A	1.202	0.63
11_A	46_V	1.189	0.62
65_V	121_I	1.188	0.62
61_E	103_F	1.187	0.62
71_V	116_V	1.176	0.61
75_T	110_T	1.169	0.61
62_R	85_S	1.168	0.61
52_V	128_V	1.151	0.60
61_E	85_S	1.150	0.60
118_P	138_V	1.146	0.59
85_S	90_F	1.145	0.59
61_E	90_F	1.141	0.59
77_E	108_D	1.132	0.58
65_V	141_A	1.129	0.58
67_E	88_W	1.115	0.57
56_Y	103_F	1.103	0.56
34_D	138_V	1.102	0.56
116_V	135_L	1.073	0.54
95_N	106_S	1.072	0.54
31_V	54_L	1.065	0.54
12_S	70_A	1.061	0.53
10_A	13_V	1.052	0.53
82_E	100_N	1.049	0.53
93_A	96_V	1.037	0.52
57_T	124_H	1.021	0.51
81_A	90_F	1.017	0.50
119_G	123_G	1.014	0.50
18_T	113_V	1.011	0.50
13_V	19_V	1.011	0.50
16_V	75_T	0.982	0.48
29_V	32_A	0.982	0.48
119_G	141_A	0.977	0.47
46_V	52_V	0.972	0.47
59_S	89_G	0.963	0.46
49_G	64_R	0.960	0.46
16_V	73_G	0.953	0.46
57_T	129_D	0.946	0.45
70_A	77_E	0.936	0.45
61_E	119_G	0.936	0.45
15_A	77_E	0.935	0.44
54_L	132_S	0.928	0.44
78_M	111_A	0.910	0.43
61_E	91_P	0.905	0.42
97_T	137_S	0.903	0.42
67_E	101_G	0.896	0.42
81_A	85_S	0.885	0.41
65_V	124_H	0.882	0.41
54_L	113_V	0.867	0.40
58_H	87_G	0.865	0.40
56_Y	61_E	0.859	0.39
10_A	40_R	0.854	0.39
21_A	100_N	0.851	0.39
12_S	40_R	0.849	0.39
55_E	67_E	0.835	0.38
15_A	74_E	0.834	0.38
12_S	16_V	0.832	0.37
119_G	122_A	0.831	0.37
30_L	39_Q	0.828	0.37
19_V	38_D	0.825	0.37
28_T	130_D	0.823	0.37
58_H	91_P	0.819	0.37
33_D	53_A	0.812	0.36
132_S	135_L	0.803	0.36
32_A	144_V	0.799	0.35
11_A	19_V	0.795	0.35
118_P	135_L	0.793	0.35
97_T	106_S	0.793	0.35
116_V	119_G	0.789	0.35
25_P	29_V	0.789	0.35
58_H	89_G	0.781	0.34
60_V	88_W	0.777	0.34
35_T	143_S	0.777	0.34
113_V	145_D	0.775	0.34
61_E	105_Y	0.770	0.33
32_A	69_Y	0.767	0.33
122_A	141_A	0.756	0.33
69_Y	94_A	0.748	0.32
64_R	125_T	0.744	0.32
76_L	128_V	0.741	0.32
41_Y	63_S	0.741	0.32
33_D	147_H	0.740	0.32
54_L	116_V	0.737	0.31
56_Y	63_S	0.734	0.31
125_T	132_S	0.731	0.31
20_I	47_S	0.730	0.31
91_P	103_F	0.728	0.31
78_M	81_A	0.726	0.31
17_L	75_T	0.725	0.31
15_A	137_S	0.722	0.30
95_N	114_L	0.720	0.30
70_A	110_T	0.714	0.30
62_R	88_W	0.703	0.29
125_T	134_D	0.700	0.29
15_A	38_D	0.695	0.29
62_R	83_F	0.690	0.29
67_E	119_G	0.689	0.28
12_S	49_G	0.688	0.28
33_D	38_D	0.684	0.28
11_A	30_L	0.680	0.28
36_D	48_E	0.678	0.28
126_L	148_V	0.676	0.28
67_E	99_E	0.675	0.28
103_F	141_A	0.675	0.28
33_D	145_D	0.675	0.28
81_A	114_L	0.673	0.28
20_I	77_E	0.670	0.27
56_Y	78_M	0.670	0.27
74_E	112_T	0.665	0.27
55_E	128_V	0.648	0.26
78_M	134_D	0.643	0.26
65_V	105_Y	0.642	0.26
56_Y	119_G	0.636	0.26
81_A	107_P	0.634	0.25
29_V	45_P	0.634	0.25
101_G	120_R	0.626	0.25
30_L	71_V	0.621	0.25
121_I	124_H	0.620	0.25
19_V	131_R	0.615	0.24
56_Y	121_I	0.610	0.24
76_L	94_A	0.605	0.24
24_V	130_D	0.601	0.24
35_T	67_E	0.600	0.24
48_E	74_E	0.598	0.24
81_A	88_W	0.597	0.23
16_V	151_R	0.596	0.23
91_P	96_V	0.593	0.23
17_L	24_V	0.586	0.23
38_D	144_V	0.585	0.23
83_F	90_F	0.584	0.23
21_A	40_R	0.581	0.23
56_Y	89_G	0.579	0.23
26_A	37_T	0.579	0.23
69_Y	78_M	0.576	0.22
51_T	71_V	0.574	0.22
56_Y	67_E	0.570	0.22
108_D	149_V	0.569	0.22
85_S	122_A	0.566	0.22
16_V	126_L	0.566	0.22
55_E	125_T	0.566	0.22
83_F	98_I	0.564	0.22
78_M	87_G	0.562	0.22
17_L	130_D	0.560	0.22
53_A	84_E	0.559	0.22
18_T	49_G	0.559	0.22
19_V	48_E	0.557	0.21
115_T	143_S	0.555	0.21
69_Y	92_S	0.555	0.21
62_R	98_I	0.554	0.21
54_L	140_D	0.548	0.21
90_F	107_P	0.548	0.21
28_T	62_R	0.545	0.21
17_L	23_V	0.541	0.21
52_V	118_P	0.540	0.21
22_A	70_A	0.540	0.21
60_V	124_H	0.539	0.21
93_A	103_F	0.532	0.20
45_P	70_A	0.529	0.20
90_F	135_L	0.527	0.20
94_A	106_S	0.522	0.20
30_L	34_D	0.518	0.20
100_N	120_R	0.516	0.20
20_I	127_H	0.515	0.20
25_P	90_F	0.509	0.19
79_T	96_V	0.507	0.19
85_S	105_Y	0.507	0.19
64_R	84_E	0.507	0.19
80_R	105_Y	0.506	0.19
34_D	113_V	0.502	0.19
111_A	146_L	0.501	0.19
130_D	154_L	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qtqA	1	0.638	17.3	0.94	Contact Map
2e1bA	1	0.6258	7.5	0.949	Contact Map
3hunA	1	0.6933	6.8	0.95	Contact Map
2l55A	1	0.4479	6.3	0.951	Contact Map
5ajoA	1	0.4785	5	0.953	Contact Map
2mc7A	1	0.184	4.6	0.954	Contact Map
3hb3B	1	0.9202	4.1	0.955	Contact Map
4hgkC	1	0.5951	3.5	0.956	Contact Map
4g6tB	1	0.2699	3.5	0.957	Contact Map
4zdxA	1	0.7301	3	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.