Q9HRT2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRT2 - Uncharacterized protein

UniProt:	Q9HRT2	Sequences: MASALLVVSEEGYWGEECIEPLTTLDDAGFDVTVATPSGGPAVLDERSVDTAEVDADTAEWVQEVHENDERLNDPEPLAAQTAAEYDTVVFPGGHGAEWDVNQDVDARRLLRNAVAGEDGTALVVCHTIGILAWTRTDDGDFLAEGRSITGFPNEWEEGIVDEHDRLPDGRKLPYWVEDEVVAVGADWDAELDSETSVTVDGDLVTARGPGSSAAAADRLLDELDV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	226 (204)
Sequences:	2708 (1823)
Seq/√Len:	127.6

ECOLI - HCHA
HALSA - Q9HRT2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
196_T	215_A	4.293	1.00
141_D	145_E	3.868	1.00
180_E	183_A	3.659	1.00
205_V	223_E	3.015	1.00
153_P	188_W	2.970	1.00
155_E	193_D	2.963	1.00
219_R	222_D	2.870	1.00
178_E	182_V	2.771	1.00
154_N	179_D	2.742	1.00
33_T	86_Y	2.608	1.00
91_F	107_A	2.547	1.00
148_S	187_D	2.510	1.00
82_T	85_E	2.411	1.00
147_R	202_G	2.399	1.00
41_P	73_N	2.378	1.00
189_D	197_S	2.346	1.00
114_A	119_D	2.282	1.00
148_S	189_D	2.260	1.00
116_A	138_D	2.122	1.00
77_P	80_A	2.049	1.00
198_V	219_R	2.018	1.00
159_G	193_D	1.991	1.00
123_L	220_L	1.985	1.00
115_V	203_D	1.984	1.00
142_F	184_V	1.938	1.00
200_V	223_E	1.931	1.00
180_E	184_V	1.931	1.00
24_T	218_D	1.902	1.00
116_A	137_T	1.851	1.00
200_V	219_R	1.824	1.00
25_L	220_L	1.824	1.00
79_A	106_D	1.742	1.00
88_T	220_L	1.709	1.00
192_L	195_E	1.688	1.00
215_A	219_R	1.667	1.00
30_F	221_L	1.637	1.00
23_T	27_D	1.593	1.00
18_C	34_V	1.589	1.00
83_A	113_N	1.553	1.00
103_Q	134_W	1.534	1.00
150_T	188_W	1.528	1.00
137_T	141_D	1.519	1.00
91_F	131_I	1.460	1.00
158_E	170_G	1.420	1.00
25_L	217_A	1.405	1.00
205_V	216_A	1.393	1.00
214_A	218_D	1.376	1.00
26_D	32_V	1.367	1.00
123_L	205_V	1.366	1.00
106_D	109_R	1.354	1.00
59_A	62_V	1.338	1.00
200_V	205_V	1.335	1.00
109_R	113_N	1.326	1.00
111_L	135_T	1.313	1.00
177_V	181_V	1.309	1.00
118_E	203_D	1.263	1.00
133_A	180_E	1.260	1.00
49_V	63_Q	1.260	1.00
124_V	132_L	1.255	1.00
124_V	129_I	1.246	1.00
58_T	61_W	1.244	1.00
147_R	201_D	1.223	0.99
35_A	78_L	1.211	0.99
76_E	81_Q	1.209	0.99
195_E	211_G	1.203	0.99
198_V	215_A	1.199	0.99
34_V	71_R	1.198	0.99
111_L	122_A	1.193	0.99
59_A	63_Q	1.191	0.99
28_A	221_L	1.190	0.99
70_E	74_D	1.189	0.99
178_E	190_A	1.169	0.99
115_V	147_R	1.164	0.99
132_L	204_L	1.164	0.99
35_A	76_E	1.157	0.99
16_E	213_S	1.153	0.99
21_P	213_S	1.145	0.99
26_D	71_R	1.140	0.99
21_P	90_V	1.136	0.99
13_Y	42_A	1.127	0.99
134_W	184_V	1.118	0.99
76_E	80_A	1.105	0.99
50_D	53_E	1.096	0.99
130_G	177_V	1.091	0.99
55_D	58_T	1.084	0.99
57_D	60_E	1.084	0.99
151_G	188_W	1.076	0.99
25_L	30_F	1.075	0.99
91_F	111_L	1.074	0.99
16_E	20_E	1.053	0.98
115_V	143_L	1.050	0.98
154_N	176_W	1.028	0.98
92_P	101_V	1.018	0.98
107_A	131_I	1.016	0.98
112_R	116_A	1.013	0.98
24_T	221_L	1.010	0.98
13_Y	44_L	1.007	0.98
84_A	113_N	0.999	0.98
136_R	142_F	0.989	0.98
26_D	67_E	0.986	0.98
114_A	122_A	0.982	0.98
15_G	44_L	0.981	0.98
91_F	101_V	0.981	0.98
105_V	109_R	0.976	0.97
97_A	101_V	0.975	0.97
24_T	214_A	0.960	0.97
149_I	186_A	0.950	0.97
33_T	76_E	0.945	0.97
102_N	134_W	0.943	0.97
158_E	171_R	0.940	0.97
83_A	114_A	0.940	0.97
76_E	86_Y	0.939	0.97
130_G	133_A	0.933	0.97
37_P	104_D	0.930	0.97
36_T	75_P	0.929	0.97
159_G	194_S	0.928	0.97
179_D	182_V	0.928	0.97
189_D	199_T	0.920	0.96
108_R	135_T	0.910	0.96
130_G	175_Y	0.908	0.96
108_R	112_R	0.907	0.96
194_S	211_G	0.907	0.96
125_V	216_A	0.906	0.96
14_W	48_S	0.904	0.96
25_L	32_V	0.898	0.96
156_W	208_R	0.897	0.96
84_A	117_G	0.893	0.96
148_S	201_D	0.890	0.96
83_A	110_L	0.890	0.96
55_D	61_W	0.886	0.96
40_G	75_P	0.884	0.95
215_A	218_D	0.883	0.95
176_W	179_D	0.881	0.95
89_V	111_L	0.878	0.95
115_V	122_A	0.873	0.95
126_C	210_P	0.871	0.95
197_S	200_V	0.867	0.95
15_G	49_V	0.858	0.95
218_D	222_D	0.853	0.95
133_A	177_V	0.853	0.95
152_F	194_S	0.852	0.95
69_D	73_N	0.846	0.94
153_P	156_W	0.843	0.94
148_S	199_T	0.843	0.94
42_A	75_P	0.842	0.94
155_E	159_G	0.838	0.94
22_L	26_D	0.835	0.94
79_A	104_D	0.832	0.94
200_V	222_D	0.810	0.93
55_D	59_A	0.809	0.93
17_E	126_C	0.802	0.93
98_E	175_Y	0.801	0.92
47_R	50_D	0.800	0.92
208_R	212_S	0.800	0.92
149_I	181_V	0.794	0.92
68_N	71_R	0.790	0.92
36_T	40_G	0.790	0.92
66_H	69_D	0.787	0.92
144_A	149_I	0.787	0.92
23_T	65_V	0.781	0.92
112_R	137_T	0.780	0.91
90_V	216_A	0.780	0.91
102_N	130_G	0.780	0.91
198_V	216_A	0.779	0.91
95_H	210_P	0.774	0.91
213_S	217_A	0.770	0.91
89_V	110_L	0.767	0.91
170_G	176_W	0.766	0.91
60_E	63_Q	0.766	0.91
58_T	62_V	0.765	0.91
136_R	140_G	0.764	0.91
113_N	117_G	0.761	0.90
20_E	213_S	0.758	0.90
92_P	97_A	0.752	0.90
179_D	183_A	0.744	0.89
22_L	34_V	0.739	0.89
19_I	68_N	0.739	0.89
66_H	70_E	0.737	0.89
108_R	134_W	0.736	0.89
19_I	58_T	0.732	0.89
109_R	112_R	0.731	0.89
217_A	221_L	0.729	0.88
124_V	206_T	0.727	0.88
33_T	71_R	0.723	0.88
219_R	223_E	0.722	0.88
42_A	72_L	0.706	0.87
149_I	204_L	0.703	0.87
45_D	48_S	0.698	0.86
90_V	125_V	0.698	0.86
136_R	184_V	0.697	0.86
65_V	68_N	0.696	0.86
23_T	61_W	0.696	0.86
56_A	62_V	0.695	0.86
128_T	131_I	0.692	0.86
155_E	190_A	0.687	0.85
40_G	43_V	0.685	0.85
144_A	181_V	0.683	0.85
132_L	135_T	0.681	0.85
25_L	123_L	0.678	0.85
97_A	102_N	0.674	0.84
98_E	177_V	0.674	0.84
146_G	185_G	0.669	0.84
30_F	224_L	0.668	0.84
56_A	61_W	0.667	0.84
70_E	73_N	0.663	0.83
110_L	119_D	0.657	0.83
90_V	207_A	0.657	0.83
95_H	157_E	0.655	0.83
154_N	158_E	0.647	0.82
95_H	173_L	0.646	0.82
196_T	218_D	0.645	0.82
136_R	143_L	0.644	0.81
151_G	186_A	0.643	0.81
209_G	212_S	0.642	0.81
115_V	137_T	0.642	0.81
112_R	138_D	0.642	0.81
77_P	106_D	0.636	0.81
191_E	195_E	0.635	0.81
102_N	133_A	0.634	0.80
30_F	87_D	0.630	0.80
65_V	69_D	0.629	0.80
88_T	224_L	0.628	0.80
22_L	68_N	0.628	0.80
160_I	194_S	0.623	0.79
21_P	25_L	0.623	0.79
112_R	136_R	0.623	0.79
119_D	203_D	0.619	0.79
102_N	175_Y	0.619	0.79
101_V	107_A	0.618	0.79
67_E	71_R	0.614	0.78
13_Y	92_P	0.612	0.78
123_L	216_A	0.612	0.78
203_D	220_L	0.610	0.78
22_L	32_V	0.605	0.77
115_V	118_E	0.605	0.77
207_A	216_A	0.602	0.77
81_Q	86_Y	0.601	0.77
142_F	186_A	0.599	0.77
96_G	100_D	0.598	0.77
191_E	197_S	0.592	0.76
30_F	86_Y	0.592	0.76
37_P	97_A	0.591	0.76
124_V	128_T	0.589	0.75
205_V	220_L	0.588	0.75
142_F	149_I	0.584	0.75
115_V	138_D	0.582	0.75
146_G	187_D	0.579	0.74
58_T	63_Q	0.579	0.74
78_L	111_L	0.578	0.74
83_A	117_G	0.574	0.74
148_S	197_S	0.572	0.73
58_T	214_A	0.571	0.73
108_R	194_S	0.569	0.73
188_W	197_S	0.569	0.73
89_V	107_A	0.569	0.73
99_W	172_K	0.569	0.73
181_V	186_A	0.568	0.73
182_V	187_D	0.568	0.73
18_C	92_P	0.567	0.73
45_D	95_H	0.566	0.73
153_P	209_G	0.565	0.72
112_R	143_L	0.564	0.72
200_V	203_D	0.563	0.72
19_I	213_S	0.563	0.72
25_L	88_T	0.562	0.72
129_I	181_V	0.562	0.72
157_E	209_G	0.557	0.71
110_L	114_A	0.554	0.71
20_E	214_A	0.554	0.71
56_A	59_A	0.554	0.71
34_V	42_A	0.553	0.71
89_V	114_A	0.552	0.71
15_G	36_T	0.550	0.70
57_D	61_W	0.547	0.70
22_L	65_V	0.544	0.70
37_P	78_L	0.543	0.69
161_V	170_G	0.542	0.69
196_T	200_V	0.541	0.69
178_E	188_W	0.540	0.69
33_T	87_D	0.539	0.69
156_W	209_G	0.539	0.69
107_A	111_L	0.534	0.68
177_V	180_E	0.534	0.68
154_N	182_V	0.532	0.68
129_I	204_L	0.530	0.68
61_W	68_N	0.530	0.68
95_H	160_I	0.529	0.67
86_Y	114_A	0.528	0.67
191_E	198_V	0.527	0.67
45_D	157_E	0.524	0.67
122_A	203_D	0.524	0.67
151_G	177_V	0.523	0.67
24_T	27_D	0.521	0.66
34_V	75_P	0.520	0.66
129_I	206_T	0.518	0.66
17_E	94_G	0.517	0.66
99_W	173_L	0.517	0.66
23_T	57_D	0.511	0.65
11_E	95_H	0.511	0.65
13_Y	36_T	0.509	0.65
150_T	197_S	0.507	0.64
159_G	192_L	0.507	0.64
150_T	216_A	0.504	0.64
63_Q	69_D	0.503	0.64
95_H	152_F	0.500	0.63
151_G	179_D	0.500	0.63

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4p5pA	1	0.9469	100	0.378	Contact Map
4i4nA	2	0.9425	100	0.4	Contact Map
3kklA	2	0.8938	100	0.408	Contact Map
4qyxA	2	0.9735	100	0.409	Contact Map
1u9cA	1	0.9204	100	0.409	Contact Map
3n7tA	2	0.9779	100	0.411	Contact Map
4lruA	1	0.9779	100	0.411	Contact Map
1n57A	2	0.9469	100	0.429	Contact Map
3l3bA	2	0.8584	100	0.517	Contact Map
4oggA	3	0.8274	100	0.54	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0087 seconds.