Q9HRS7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRS7 - Uncharacterized protein

UniProt:	Q9HRS7	Sequences: MMEALAAKDYYIASFLLIGIGTYVMIAAGNLVKKVIGMNIFQTGIFLFFIASAYVEGGTPPLLTSETPHVSPVPHVLILTAIVVGVALTAVALGMIVRIYDDYGTLDERTLKEVRSSD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (104)
Sequences:	1624 (932)
Seq/√Len:	91.4

BACSU - MRPC
HALSA - Q9HRS7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_I	44_G	5.199	1.00
24_V	37_G	4.594	1.00
29_G	107_D	2.934	1.00
99_I	111_L	2.758	1.00
30_N	106_L	2.734	1.00
46_F	78_I	2.504	1.00
39_N	89_T	2.421	1.00
105_T	110_T	2.182	1.00
74_P	77_L	2.176	1.00
21_G	41_F	1.984	1.00
91_V	95_M	1.970	1.00
99_I	103_Y	1.928	1.00
107_D	110_T	1.919	1.00
42_Q	81_A	1.902	1.00
49_F	53_A	1.885	1.00
15_F	19_G	1.874	1.00
18_I	45_I	1.807	1.00
35_V	89_T	1.655	1.00
28_A	33_K	1.555	1.00
49_F	78_I	1.554	1.00
32_V	96_I	1.545	1.00
89_T	93_L	1.493	1.00
24_V	28_A	1.488	1.00
18_I	41_F	1.427	0.99
64_T	68_P	1.350	0.99
31_L	107_D	1.338	0.99
22_T	27_A	1.286	0.99
35_V	96_I	1.274	0.99
42_Q	84_V	1.258	0.99
46_F	49_F	1.241	0.98
46_F	84_V	1.233	0.98
35_V	92_A	1.230	0.98
21_G	94_G	1.223	0.98
98_R	101_D	1.201	0.98
46_F	81_A	1.196	0.98
76_V	84_V	1.187	0.98
95_M	98_R	1.177	0.98
25_M	38_M	1.150	0.97
46_F	53_A	1.135	0.97
45_I	62_L	1.128	0.97
19_G	27_A	1.116	0.97
71_S	89_T	1.075	0.96
38_M	47_L	1.060	0.96
34_K	108_E	1.053	0.96
88_L	95_M	1.040	0.95
10_Y	51_A	1.037	0.95
19_G	23_Y	1.036	0.95
33_K	48_F	1.008	0.94
16_L	70_V	0.994	0.94
104_G	108_E	0.990	0.94
79_L	82_I	0.987	0.94
85_G	94_G	0.984	0.94
70_V	75_H	0.984	0.94
71_S	75_H	0.974	0.93
20_I	40_I	0.969	0.93
37_G	40_I	0.946	0.92
53_A	74_P	0.908	0.91
60_P	88_L	0.885	0.89
39_N	45_I	0.883	0.89
29_G	98_R	0.876	0.89
43_T	48_F	0.872	0.89
10_Y	13_A	0.864	0.88
35_V	49_F	0.862	0.88
34_K	84_V	0.859	0.88
32_V	78_I	0.855	0.88
59_T	68_P	0.853	0.88
23_Y	95_M	0.844	0.87
25_M	39_N	0.837	0.87
41_F	76_V	0.835	0.87
30_N	99_I	0.829	0.86
42_Q	85_G	0.824	0.86
99_I	106_L	0.820	0.86
96_I	106_L	0.816	0.85
14_S	44_G	0.801	0.84
11_Y	31_L	0.794	0.84
71_S	88_L	0.789	0.83
25_M	90_A	0.778	0.82
71_S	84_V	0.766	0.81
25_M	104_G	0.764	0.81
76_V	86_V	0.759	0.81
47_L	70_V	0.758	0.81
62_L	72_P	0.754	0.80
54_Y	106_L	0.743	0.79
53_A	75_H	0.742	0.79
104_G	107_D	0.738	0.79
92_A	99_I	0.731	0.78
56_E	70_V	0.730	0.78
81_A	85_G	0.727	0.78
25_M	41_F	0.725	0.78
54_Y	70_V	0.717	0.77
91_V	98_R	0.713	0.77
50_I	86_V	0.696	0.75
21_G	44_G	0.694	0.75
68_P	92_A	0.685	0.74
37_G	79_L	0.680	0.73
25_M	70_V	0.677	0.73
64_T	69_H	0.672	0.72
42_Q	69_H	0.668	0.72
50_I	78_I	0.668	0.72
25_M	47_L	0.665	0.72
23_Y	77_L	0.661	0.71
9_D	68_P	0.655	0.70
43_T	91_V	0.654	0.70
95_M	105_T	0.650	0.70
15_F	86_V	0.648	0.70
100_Y	107_D	0.645	0.69
77_L	107_D	0.645	0.69
79_L	95_M	0.643	0.69
13_A	57_G	0.626	0.67
24_V	40_I	0.622	0.66
54_Y	58_G	0.621	0.66
35_V	98_R	0.620	0.66
42_Q	90_A	0.619	0.66
8_K	12_I	0.618	0.66
75_H	84_V	0.615	0.66
40_I	52_S	0.613	0.65
16_L	20_I	0.612	0.65
31_L	96_I	0.611	0.65
17_L	95_M	0.604	0.64
12_I	19_G	0.603	0.64
56_E	63_L	0.602	0.64
61_P	91_V	0.601	0.64
58_G	90_A	0.598	0.63
13_A	51_A	0.596	0.63
29_G	56_E	0.594	0.63
36_I	85_G	0.594	0.63
23_Y	27_A	0.593	0.63
42_Q	95_M	0.582	0.61
33_K	93_L	0.581	0.61
27_A	42_Q	0.578	0.61
71_S	106_L	0.578	0.61
43_T	97_V	0.577	0.61
54_Y	86_V	0.577	0.61
91_V	94_G	0.575	0.60
34_K	103_Y	0.574	0.60
12_I	15_F	0.566	0.59
29_G	94_G	0.564	0.59
33_K	97_V	0.563	0.59
9_D	64_T	0.561	0.59
59_T	87_A	0.553	0.57
59_T	67_T	0.546	0.57
35_V	43_T	0.539	0.56
13_A	96_I	0.538	0.55
13_A	17_L	0.538	0.55
54_Y	97_V	0.523	0.53
57_G	61_P	0.519	0.53
53_A	77_L	0.518	0.53
60_P	90_A	0.516	0.52
86_V	94_G	0.514	0.52
12_I	16_L	0.514	0.52
81_A	84_V	0.512	0.52
24_V	36_I	0.512	0.52
8_K	21_G	0.511	0.52
38_M	45_I	0.508	0.51
11_Y	42_Q	0.503	0.51
87_A	100_Y	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rkoK	1	0.8475	99.6	0.568	Contact Map
4he8K	1	0.8051	99.6	0.589	Contact Map
2kncB	1	0.4322	8	0.936	Contact Map
3rkoL	1	0.8305	7.2	0.937	Contact Map
1lnqA	6	0.6356	7.2	0.937	Contact Map
3rkoM	1	0.8475	7.1	0.937	Contact Map
2kluA	1	0.4068	6.6	0.938	Contact Map
3rkoN	1	0.839	6.4	0.939	Contact Map
2kncA	1	0.4322	5.7	0.94	Contact Map
4he8M	1	0.8475	5.5	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.