Q9HRS6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRS6 - Uncharacterized protein

UniProt:	Q9HRS6	Sequences: MSDRPSSSQRQSYIESSIIMGTVRVVSPFVFTYGLFVMFHGADSAGGGFQGGVIVATVMLMLGIAFGIDPVREWVGERLLVAIVVGGVTAFLAVASSTVLLGGAFLDVSVFGGHHASKYSIEIIELFIGAIVASTITGLFIAIDAGTSDDGGNDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (132)
Sequences:	1624 (1024)
Seq/√Len:	89.2

BACSU - MRPB
HALSA - Q9HRS6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_G	129_G	6.691	1.00
37_V	54_I	4.622	1.00
112_G	115_H	4.039	1.00
34_G	55_V	3.597	1.00
55_V	129_G	3.391	1.00
38_M	126_L	3.023	1.00
95_A	105_F	2.780	1.00
110_V	117_S	2.700	1.00
112_G	117_S	2.295	1.00
88_V	131_I	2.292	1.00
103_G	107_D	2.065	1.00
104_A	107_D	1.985	1.00
95_A	106_L	1.740	1.00
27_S	30_V	1.732	1.00
97_S	120_S	1.645	1.00
94_V	123_I	1.631	1.00
20_M	66_F	1.577	1.00
34_G	51_G	1.538	1.00
20_M	24_R	1.530	1.00
103_G	109_S	1.511	1.00
67_G	70_P	1.483	1.00
19_I	61_M	1.456	0.99
84_V	88_V	1.447	0.99
97_S	123_I	1.414	0.99
113_G	118_K	1.391	0.99
86_G	130_A	1.374	0.99
87_G	127_F	1.349	0.99
89_T	93_A	1.335	0.99
92_L	96_S	1.325	0.99
35_L	39_F	1.311	0.99
88_V	125_E	1.299	0.99
95_A	98_T	1.289	0.99
83_I	134_S	1.289	0.99
90_A	130_A	1.266	0.98
31_F	58_V	1.246	0.98
78_R	81_V	1.243	0.98
120_S	124_I	1.236	0.98
43_D	117_S	1.234	0.98
31_F	55_V	1.209	0.98
96_S	99_V	1.194	0.98
23_V	65_A	1.174	0.97
27_S	93_A	1.168	0.97
63_G	141_I	1.157	0.97
51_G	146_G	1.129	0.97
118_K	122_E	1.126	0.97
43_D	50_Q	1.123	0.97
36_F	39_F	1.115	0.97
39_F	74_W	1.108	0.96
38_M	129_G	1.107	0.96
120_S	123_I	1.107	0.96
99_V	102_G	1.097	0.96
125_E	131_I	1.093	0.96
113_G	117_S	1.072	0.96
60_L	136_I	1.068	0.96
72_R	145_A	1.058	0.95
30_V	58_V	1.055	0.95
124_I	127_F	1.049	0.95
53_V	124_I	1.045	0.95
78_R	82_A	1.045	0.95
40_H	53_V	1.034	0.95
91_F	124_I	1.031	0.95
110_V	119_Y	1.027	0.95
120_S	125_E	1.018	0.94
75_V	79_L	1.016	0.94
27_S	62_L	1.005	0.94
36_F	54_I	0.991	0.93
115_H	119_Y	0.985	0.93
15_E	20_M	0.984	0.93
97_S	109_S	0.983	0.93
123_I	131_I	0.972	0.93
98_T	103_G	0.970	0.93
97_S	101_L	0.957	0.92
30_V	33_Y	0.956	0.92
15_E	57_T	0.950	0.92
51_G	57_T	0.940	0.92
61_M	75_V	0.937	0.91
60_L	143_I	0.933	0.91
96_S	100_L	0.923	0.91
58_V	142_A	0.912	0.90
86_G	90_A	0.897	0.90
125_E	129_G	0.892	0.89
93_A	97_S	0.881	0.89
98_T	107_D	0.877	0.88
85_V	128_I	0.877	0.88
67_G	145_A	0.875	0.88
71_V	76_G	0.868	0.88
108_V	119_Y	0.864	0.88
52_G	88_V	0.858	0.87
72_R	141_I	0.847	0.87
116_A	135_T	0.842	0.86
37_V	56_A	0.840	0.86
63_G	72_R	0.835	0.86
36_F	40_H	0.827	0.85
94_V	97_S	0.821	0.85
18_I	21_G	0.809	0.84
55_V	58_V	0.799	0.83
45_A	132_V	0.798	0.83
122_E	126_L	0.792	0.83
25_V	71_V	0.788	0.82
110_V	121_I	0.783	0.82
22_T	89_T	0.769	0.81
89_T	96_S	0.769	0.81
93_A	98_T	0.765	0.81
99_V	105_F	0.762	0.80
56_A	138_G	0.761	0.80
90_A	93_A	0.760	0.80
83_I	130_A	0.760	0.80
64_I	144_D	0.756	0.80
34_G	54_I	0.754	0.80
70_P	73_E	0.754	0.80
138_G	142_A	0.753	0.80
34_G	68_I	0.744	0.79
19_I	22_T	0.743	0.79
17_S	23_V	0.741	0.78
71_V	141_I	0.741	0.78
35_L	38_M	0.740	0.78
33_Y	137_T	0.736	0.78
118_K	125_E	0.735	0.78
96_S	105_F	0.732	0.78
96_S	107_D	0.713	0.76
129_G	144_D	0.708	0.75
64_I	95_A	0.708	0.75
59_M	71_V	0.707	0.75
23_V	30_V	0.706	0.75
38_M	42_A	0.706	0.75
84_V	135_T	0.705	0.75
77_E	83_I	0.703	0.75
25_V	36_F	0.700	0.74
40_H	124_I	0.699	0.74
122_E	133_A	0.691	0.73
64_I	67_G	0.687	0.73
19_I	83_I	0.684	0.73
113_G	116_A	0.679	0.72
109_S	119_Y	0.672	0.71
70_P	74_W	0.670	0.71
56_A	136_I	0.670	0.71
108_V	121_I	0.669	0.71
40_H	50_Q	0.659	0.70
55_V	65_A	0.658	0.70
82_A	86_G	0.657	0.70
97_S	103_G	0.649	0.69
101_L	109_S	0.645	0.68
73_E	99_V	0.627	0.66
68_I	72_R	0.615	0.65
44_S	60_L	0.614	0.64
38_M	125_E	0.609	0.64
62_L	65_A	0.607	0.64
57_T	81_V	0.603	0.63
84_V	131_I	0.599	0.63
108_V	143_I	0.594	0.62
135_T	139_L	0.590	0.61
121_I	125_E	0.588	0.61
36_F	64_I	0.587	0.61
98_T	105_F	0.587	0.61
108_V	120_S	0.583	0.60
62_L	71_V	0.579	0.60
40_H	44_S	0.578	0.60
28_P	74_W	0.576	0.60
68_I	141_I	0.575	0.59
23_V	58_V	0.572	0.59
87_G	90_A	0.571	0.59
119_Y	122_E	0.571	0.59
26_V	58_V	0.571	0.59
29_F	78_R	0.570	0.59
32_T	78_R	0.570	0.59
27_S	81_V	0.568	0.58
22_T	26_V	0.567	0.58
27_S	77_E	0.563	0.58
14_I	145_A	0.559	0.57
117_S	121_I	0.559	0.57
57_T	64_I	0.554	0.57
93_A	101_L	0.551	0.56
23_V	27_S	0.551	0.56
139_L	142_A	0.551	0.56
23_V	73_E	0.549	0.56
43_D	135_T	0.548	0.56
94_V	110_V	0.546	0.56
121_I	137_T	0.545	0.55
116_A	139_L	0.544	0.55
34_G	125_E	0.542	0.55
84_V	98_T	0.541	0.55
63_G	71_V	0.538	0.54
96_S	136_I	0.535	0.54
34_G	38_M	0.531	0.54
29_F	53_V	0.530	0.53
51_G	135_T	0.525	0.53
83_I	86_G	0.518	0.52
52_G	142_A	0.516	0.51
110_V	123_I	0.510	0.51
19_I	23_V	0.508	0.50
21_G	65_A	0.508	0.50
38_M	51_G	0.508	0.50
42_A	124_I	0.507	0.50
131_I	135_T	0.505	0.50
68_I	136_I	0.502	0.50
68_I	139_L	0.501	0.49
31_F	122_E	0.501	0.49
61_M	122_E	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4od4A	1	0.8516	22.8	0.931	Contact Map
1pw4A	1	0.871	7.1	0.945	Contact Map
2bg9B	1	0.3355	6.9	0.945	Contact Map
4tphA	2	0.7677	6.5	0.946	Contact Map
3s8fA	1	0.9548	6	0.947	Contact Map
3j1zP	8	0.9419	5.9	0.947	Contact Map
3wdoA	1	0.8516	5	0.949	Contact Map
4o6yA	2	0.8839	4.9	0.949	Contact Map
3pjzA	2	0.8065	4.6	0.95	Contact Map
4fc4A	3	0.8323	4.5	0.95	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.