Q9HRS5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRS5 - Uncharacterized protein

UniProt:	Q9HRS5	Sequences: MNIELPLLVFVVATALATTVLRDVLASIIAFATYSLGVAVVWVVLQAPDVGLTEAAVGAGVTTVLFLLTIAKTVRPGDEAVFERLNVPAFGAAVVLVGALLTTVHALPTIGDPSNIAVTSEVTRYYIDHAYHEAGVKNVVTAVLASYRGFDTLGEAVVVYSAGVGLLVVLRREVFA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	176 (160)
Sequences:	1574 (1099)
Seq/√Len:	86.9

BACSU - MRPA
HALSA - Q9HRS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
127_I	139_V	5.892	1.00
136_V	142_A	5.609	1.00
129_H	133_E	4.597	1.00
124_R	128_D	4.144	1.00
94_V	98_G	3.698	1.00
131_Y	137_K	3.625	1.00
101_L	105_H	3.067	1.00
120_S	124_R	2.987	1.00
11_V	37_G	2.949	1.00
36_L	60_G	2.291	1.00
125_Y	129_H	2.254	1.00
90_F	93_A	2.248	1.00
85_L	88_P	2.172	1.00
32_A	63_T	2.046	1.00
17_A	30_A	2.026	1.00
90_F	94_V	2.011	1.00
87_V	91_G	1.995	1.00
134_A	142_A	1.957	1.00
98_G	101_L	1.952	1.00
136_V	141_T	1.933	1.00
14_T	63_T	1.827	1.00
91_G	95_V	1.764	1.00
28_I	70_I	1.732	1.00
129_H	132_H	1.691	1.00
98_G	102_T	1.674	1.00
16_L	20_V	1.630	1.00
9_V	13_A	1.532	1.00
18_T	30_A	1.503	1.00
134_A	146_S	1.484	0.99
23_D	76_P	1.453	0.99
141_T	145_A	1.398	0.99
8_L	12_V	1.377	0.99
93_A	96_L	1.374	0.99
39_A	55_A	1.353	0.99
35_S	58_G	1.336	0.99
6_P	9_V	1.327	0.99
129_H	147_Y	1.321	0.99
26_A	153_L	1.320	0.99
64_V	104_V	1.315	0.99
121_E	124_R	1.296	0.99
53_T	138_N	1.293	0.99
54_E	58_G	1.286	0.98
82_F	85_L	1.252	0.98
134_A	144_L	1.251	0.98
11_V	16_L	1.211	0.98
87_V	90_F	1.177	0.97
21_L	26_A	1.158	0.97
65_L	144_L	1.147	0.97
122_V	126_Y	1.143	0.97
61_V	65_L	1.129	0.97
85_L	89_A	1.127	0.97
8_L	11_V	1.126	0.97
126_Y	143_V	1.122	0.96
8_L	15_A	1.097	0.96
82_F	87_V	1.082	0.96
136_V	146_S	1.074	0.95
153_L	157_V	1.043	0.95
96_L	107_L	1.037	0.94
14_T	33_T	1.021	0.94
134_A	137_K	1.016	0.94
123_T	142_A	1.008	0.94
16_L	19_T	1.002	0.93
29_I	61_V	0.998	0.93
17_A	26_A	0.997	0.93
125_Y	149_G	0.994	0.93
50_V	54_E	0.992	0.93
14_T	37_G	0.990	0.93
53_T	141_T	0.988	0.93
131_Y	134_A	0.988	0.93
42_W	60_G	0.984	0.93
41_V	157_V	0.984	0.93
58_G	146_S	0.962	0.92
107_L	153_L	0.962	0.92
142_A	145_A	0.950	0.91
37_G	163_G	0.947	0.91
84_R	88_P	0.939	0.91
35_S	159_V	0.930	0.91
63_T	67_L	0.928	0.90
11_V	15_A	0.928	0.90
106_A	110_I	0.926	0.90
7_L	44_V	0.918	0.90
102_T	106_A	0.909	0.90
128_D	133_E	0.900	0.89
42_W	146_S	0.898	0.89
76_P	169_V	0.891	0.89
12_V	16_L	0.883	0.88
82_F	90_F	0.880	0.88
32_A	44_V	0.880	0.88
34_Y	71_A	0.877	0.88
46_Q	89_A	0.872	0.87
144_L	153_L	0.872	0.87
26_A	29_I	0.867	0.87
22_R	77_G	0.867	0.87
107_L	111_G	0.858	0.87
149_G	163_G	0.858	0.87
78_D	82_F	0.858	0.87
96_L	100_L	0.857	0.87
39_A	165_G	0.855	0.86
55_A	157_V	0.851	0.86
61_V	67_L	0.850	0.86
15_A	34_Y	0.848	0.86
128_D	132_H	0.848	0.86
56_A	67_L	0.846	0.86
13_A	20_V	0.841	0.86
52_L	135_G	0.839	0.85
50_V	140_V	0.838	0.85
112_D	123_T	0.834	0.85
54_E	141_T	0.829	0.85
27_S	64_V	0.825	0.84
123_T	127_I	0.825	0.84
18_T	166_L	0.824	0.84
61_V	81_V	0.818	0.84
40_V	44_V	0.809	0.83
126_Y	147_Y	0.809	0.83
85_L	90_F	0.805	0.83
98_G	124_R	0.793	0.82
34_Y	166_L	0.785	0.81
163_G	170_L	0.783	0.81
36_L	43_V	0.781	0.81
83_E	86_N	0.777	0.81
126_Y	139_V	0.767	0.80
86_N	89_A	0.767	0.80
13_A	82_F	0.765	0.80
12_V	90_F	0.758	0.79
32_A	143_V	0.758	0.79
67_L	166_L	0.746	0.78
77_G	80_A	0.741	0.77
53_T	145_A	0.739	0.77
23_D	77_G	0.736	0.77
54_E	146_S	0.734	0.77
141_T	144_L	0.734	0.77
100_L	103_T	0.733	0.77
147_Y	150_F	0.728	0.76
5_L	87_V	0.727	0.76
57_V	135_G	0.722	0.76
58_G	154_G	0.722	0.76
84_R	87_V	0.721	0.76
165_G	169_V	0.721	0.76
57_V	154_G	0.719	0.75
55_A	144_L	0.717	0.75
125_Y	147_Y	0.715	0.75
46_Q	69_T	0.707	0.74
43_V	46_Q	0.706	0.74
21_L	27_S	0.706	0.74
17_A	20_V	0.699	0.73
163_G	167_L	0.697	0.73
14_T	30_A	0.693	0.73
41_V	45_L	0.691	0.72
151_D	155_E	0.690	0.72
152_T	155_E	0.690	0.72
8_L	57_V	0.689	0.72
30_A	43_V	0.687	0.72
44_V	75_R	0.686	0.72
61_V	108_P	0.686	0.72
31_F	42_W	0.679	0.71
126_Y	130_A	0.677	0.71
31_F	139_V	0.673	0.70
53_T	122_V	0.667	0.70
46_Q	70_I	0.660	0.69
42_W	141_T	0.658	0.69
105_H	127_I	0.657	0.69
131_Y	142_A	0.656	0.68
9_V	85_L	0.654	0.68
31_F	56_A	0.653	0.68
126_Y	135_G	0.651	0.68
45_L	67_L	0.648	0.68
7_L	40_V	0.648	0.68
153_L	161_S	0.644	0.67
84_R	91_G	0.640	0.67
31_F	34_Y	0.638	0.66
30_A	71_A	0.635	0.66
150_F	153_L	0.633	0.66
50_V	164_V	0.629	0.65
134_A	156_A	0.628	0.65
31_F	45_L	0.625	0.65
122_V	142_A	0.614	0.63
64_V	70_I	0.612	0.63
23_D	171_R	0.612	0.63
16_L	30_A	0.611	0.63
71_A	165_G	0.609	0.63
108_P	111_G	0.609	0.63
91_G	102_T	0.608	0.63
95_V	98_G	0.606	0.62
20_V	25_L	0.605	0.62
102_T	168_V	0.605	0.62
92_A	109_T	0.605	0.62
145_A	163_G	0.604	0.62
133_E	147_Y	0.598	0.61
5_L	10_F	0.596	0.61
92_A	132_H	0.595	0.61
52_L	106_A	0.593	0.61
131_Y	144_L	0.593	0.61
143_V	147_Y	0.592	0.61
56_A	150_F	0.590	0.60
54_E	136_V	0.589	0.60
155_E	158_V	0.589	0.60
9_V	78_D	0.587	0.60
55_A	58_G	0.582	0.59
8_L	18_T	0.582	0.59
103_T	110_I	0.581	0.59
35_S	146_S	0.579	0.59
52_L	62_T	0.577	0.59
50_V	141_T	0.576	0.59
100_L	127_I	0.574	0.58
43_V	77_G	0.572	0.58
54_E	145_A	0.571	0.58
54_E	60_G	0.570	0.58
15_A	19_T	0.569	0.58
142_A	149_G	0.563	0.57
34_Y	60_G	0.558	0.56
60_G	146_S	0.556	0.56
67_L	159_V	0.555	0.56
14_T	34_Y	0.555	0.56
138_N	141_T	0.554	0.56
54_E	63_T	0.552	0.55
25_L	29_I	0.549	0.55
148_R	151_D	0.548	0.55
148_R	152_T	0.548	0.55
134_A	147_Y	0.546	0.55
141_T	146_S	0.545	0.54
136_V	144_L	0.541	0.54
52_L	103_T	0.540	0.54
139_V	149_G	0.539	0.54
35_S	168_V	0.539	0.54
56_A	168_V	0.539	0.54
128_D	131_Y	0.538	0.53
139_V	161_S	0.537	0.53
21_L	28_I	0.535	0.53
21_L	78_D	0.533	0.53
58_G	141_T	0.531	0.53
47_A	162_A	0.518	0.51
7_L	170_L	0.515	0.50
53_T	68_L	0.513	0.50
24_V	159_V	0.512	0.50
68_L	74_V	0.510	0.50
28_I	95_V	0.505	0.49
29_I	92_A	0.504	0.49
130_A	142_A	0.503	0.49
70_I	73_T	0.503	0.49
164_V	167_L	0.500	0.48

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4he8J	1	0.8977	97.5	0.844	Contact Map
3rkoJ	1	0.8977	95.2	0.878	Contact Map
4r0cA	3	0.4773	11.4	0.947	Contact Map
3dh4A	3	0.6193	10	0.949	Contact Map
3w4tA	1	0.4432	4.2	0.957	Contact Map
2nq2A	2	0.8295	3.5	0.959	Contact Map
2p1gA	1	0.2955	3.2	0.959	Contact Map
4he8K	1	0.4886	2.7	0.961	Contact Map
3mktA	1	0.4886	2.5	0.961	Contact Map
3rkoK	1	0.4886	2.5	0.961	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.