Q9HRR7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRR7 - Uncharacterized protein

UniProt:	Q9HRR7	Sequences: MTTAPAKISEYTVSTPDRTVASVRADGIVAATPLGSHGYAADAGGPHLAPGVSAAAVVPVSPFRVDRTNWVVCPPVSVTVARDETTVELHADGHAHGRVPVDSPVTLSWGTPLPIAVVSHAGTHGD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (117)
Sequences:	3348 (2147)
Seq/√Len:	198.5

ECOLI - NADK
BACSU - NADK2 NADK1
HALSA - Q9HRR7 NADK
SULSO - NADK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
77_S	108_S	3.717	1.00
79_T	104_P	3.674	1.00
16_P	76_V	3.591	1.00
53_S	74_P	3.335	1.00
40_A	58_V	3.201	1.00
79_T	106_T	2.953	1.00
12_T	81_A	2.817	1.00
81_A	104_P	2.724	1.00
11_Y	80_V	2.690	1.00
77_S	106_T	2.463	1.00
48_L	56_A	2.280	1.00
57_V	72_V	2.200	1.00
14_S	19_T	2.093	1.00
14_S	81_A	2.059	1.00
17_D	79_T	2.055	1.00
13_V	57_V	1.972	1.00
43_A	58_V	1.934	1.00
9_S	87_V	1.885	1.00
14_S	79_T	1.809	1.00
37_H	47_H	1.787	1.00
100_P	103_S	1.669	1.00
15_T	78_V	1.669	1.00
18_R	122_G	1.653	1.00
46_P	56_A	1.621	1.00
19_T	22_S	1.596	1.00
43_A	61_S	1.584	1.00
17_D	77_S	1.555	1.00
48_L	54_A	1.547	1.00
65_V	68_T	1.535	1.00
29_V	43_A	1.486	1.00
31_A	56_A	1.429	1.00
15_T	76_V	1.358	1.00
12_T	22_S	1.315	1.00
46_P	71_V	1.274	1.00
53_S	109_W	1.273	1.00
49_A	73_C	1.244	1.00
30_A	107_L	1.204	1.00
41_A	63_F	1.197	1.00
48_L	71_V	1.195	1.00
86_T	100_P	1.191	1.00
41_A	65_V	1.176	1.00
30_A	80_V	1.173	1.00
10_E	24_R	1.168	1.00
15_T	72_V	1.156	1.00
30_A	55_A	1.150	1.00
28_I	57_V	1.125	1.00
7_K	93_G	1.124	1.00
53_S	112_P	1.111	1.00
88_E	96_H	1.084	1.00
86_T	98_R	1.060	1.00
15_T	20_V	1.027	1.00
13_V	28_I	1.017	1.00
11_Y	25_A	1.016	1.00
49_A	76_V	1.014	1.00
34_L	50_P	0.979	1.00
72_V	78_V	0.965	0.99
51_G	73_C	0.963	0.99
74_P	109_W	0.957	0.99
88_E	98_R	0.949	0.99
23_V	47_H	0.937	0.99
27_G	60_V	0.918	0.99
16_P	77_S	0.910	0.99
53_S	75_P	0.906	0.99
109_W	112_P	0.897	0.99
56_A	71_V	0.895	0.99
14_S	17_D	0.890	0.99
64_R	93_G	0.875	0.99
89_L	99_V	0.870	0.99
12_T	19_T	0.864	0.99
30_A	57_V	0.859	0.99
7_K	94_H	0.852	0.99
13_V	80_V	0.841	0.98
55_A	78_V	0.835	0.98
6_A	61_S	0.829	0.98
23_V	67_R	0.827	0.98
62_P	68_T	0.824	0.98
72_V	76_V	0.819	0.98
99_V	105_V	0.802	0.98
41_A	46_P	0.789	0.98
90_H	96_H	0.768	0.97
51_G	95_A	0.766	0.97
10_E	22_S	0.765	0.97
58_V	69_N	0.752	0.97
41_A	47_H	0.749	0.97
82_R	86_T	0.738	0.97
25_A	64_R	0.732	0.96
29_V	59_P	0.731	0.96
40_A	56_A	0.724	0.96
13_V	23_V	0.722	0.96
43_A	60_V	0.721	0.96
21_A	63_F	0.717	0.96
75_P	114_P	0.710	0.96
42_D	111_T	0.708	0.96
42_D	45_G	0.697	0.95
54_A	71_V	0.696	0.95
17_D	106_T	0.696	0.95
20_V	72_V	0.693	0.95
118_V	121_A	0.692	0.95
82_R	99_V	0.685	0.95
80_V	107_L	0.683	0.95
86_T	95_A	0.679	0.95
75_P	109_W	0.678	0.94
106_T	109_W	0.669	0.94
44_G	92_D	0.669	0.94
7_K	90_H	0.667	0.94
42_D	67_R	0.664	0.94
66_D	69_N	0.663	0.94
8_I	11_Y	0.661	0.94
63_F	118_V	0.660	0.94
21_A	38_G	0.659	0.94
83_D	86_T	0.655	0.93
26_D	39_Y	0.651	0.93
57_V	70_W	0.650	0.93
9_S	28_I	0.639	0.93
36_S	56_A	0.630	0.92
23_V	59_P	0.628	0.92
20_V	23_V	0.626	0.92
55_A	76_V	0.626	0.92
54_A	69_N	0.623	0.92
41_A	68_T	0.610	0.91
51_G	75_P	0.594	0.90
39_Y	60_V	0.593	0.90
30_A	78_V	0.593	0.90
84_E	101_V	0.591	0.89
34_L	37_H	0.591	0.89
34_L	90_H	0.590	0.89
52_V	55_A	0.586	0.89
60_V	68_T	0.582	0.89
28_I	80_V	0.581	0.89
94_H	103_S	0.580	0.88
82_R	85_T	0.580	0.88
90_H	93_G	0.580	0.88
8_I	63_F	0.571	0.88
13_V	72_V	0.570	0.88
24_R	118_V	0.569	0.88
23_V	63_F	0.569	0.88
85_T	88_E	0.565	0.87
11_Y	87_V	0.564	0.87
39_Y	89_L	0.563	0.87
59_P	62_P	0.562	0.87
64_R	68_T	0.561	0.87
11_Y	28_I	0.559	0.87
106_T	111_T	0.551	0.86
60_V	90_H	0.549	0.86
49_A	66_D	0.548	0.86
75_P	108_S	0.545	0.85
88_E	95_A	0.545	0.85
24_R	63_F	0.544	0.85
98_R	101_V	0.540	0.85
116_A	121_A	0.536	0.84
62_P	70_W	0.535	0.84
60_V	96_H	0.532	0.84
39_Y	78_V	0.529	0.83
63_F	68_T	0.529	0.83
64_R	107_L	0.528	0.83
73_C	76_V	0.527	0.83
64_R	67_R	0.526	0.83
47_H	65_V	0.525	0.83
42_D	76_V	0.523	0.83
38_G	41_A	0.523	0.83
42_D	63_F	0.522	0.83
7_K	95_A	0.522	0.83
77_S	86_T	0.521	0.83
63_F	105_V	0.520	0.82
111_T	120_H	0.519	0.82
83_D	101_V	0.518	0.82
7_K	20_V	0.518	0.82
117_V	121_A	0.517	0.82
46_P	109_W	0.515	0.82
89_L	103_S	0.513	0.82
81_A	106_T	0.511	0.81
116_A	119_S	0.509	0.81
61_S	87_V	0.508	0.81
99_V	103_S	0.508	0.81
103_S	106_T	0.507	0.81
32_T	88_E	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pfnA	4	1	100	0.125	Contact Map
3afoA	4	0.9921	100	0.192	Contact Map
2an1A	4	1	100	0.33	Contact Map
1u0tA	4	1	100	0.334	Contact Map
1yt5A	4	0.9524	100	0.379	Contact Map
1z0sA	4	0.9524	100	0.388	Contact Map
2i2cA	3	0.9921	99.9	0.399	Contact Map
2qv7A	2	0.9048	99.2	0.703	Contact Map
3s40A	3	0.8651	98.9	0.738	Contact Map
4werA	2	0.8651	98.5	0.769	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.