Q9HRQ5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRQ5 - Endonuclease III

UniProt:	Q9HRQ5	Sequences: MGTRLETRSAQVGTVIDRLREQHPDPEISLRFSSRMELLVAVILSAQCTDERVNAETEHLFDTYETVADYANADEEALAAELNSITYYNSKAGYIKSAAQSILEDHDGAVPDTMSDLTDLSGVGRKTANVVLQHGHDLTQGIVVDTHVQRLSRRLGITEKKRPEAIETDLMPVVPEDHWKNYTHWLIAHGRETCTARNPDCGACVLADICPSSKTDHDIDLADGSEW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (202)
Sequences:	8405 (5264)
Seq/√Len:	370.4

ECOLI - END3 MUTY
BACSU - END3 YFHQ
HALSA - Q9HRQ5 Q9HS56 Q9HPQ6
SULSO - Q97VX0 Q7LXY0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
113_T	116_D	3.918	1.00
66_T	69_D	3.511	1.00
200_D	203_A	3.261	1.00
101_S	105_D	3.158	1.00
112_D	138_L	2.800	1.00
195_T	200_D	2.701	1.00
63_T	77_A	2.686	1.00
101_S	121_S	2.590	1.00
78_L	96_K	2.475	1.00
96_K	100_Q	2.343	1.00
63_T	81_E	2.314	1.00
20_R	178_H	2.298	1.00
114_M	118_T	2.262	1.00
106_H	119_D	2.233	1.00
80_A	83_N	2.174	1.00
164_E	168_T	2.090	1.00
68_A	103_L	2.043	1.00
207_A	213_S	2.010	1.00
43_I	98_A	2.006	1.00
34_S	37_E	1.981	1.00
65_E	69_D	1.972	1.00
100_Q	104_E	1.955	1.00
94_Y	97_S	1.908	1.00
75_E	79_A	1.874	1.00
74_D	77_A	1.860	1.00
97_S	121_S	1.833	1.00
90_S	94_Y	1.829	1.00
20_R	181_N	1.814	1.00
75_E	96_K	1.796	1.00
105_D	119_D	1.759	1.00
64_Y	73_A	1.719	1.00
40_V	95_I	1.713	1.00
68_A	72_N	1.694	1.00
36_M	67_V	1.681	1.00
58_E	62_D	1.624	1.00
149_Q	166_I	1.602	1.00
18_R	208_D	1.589	1.00
116_D	119_D	1.588	1.00
103_L	108_G	1.525	1.00
114_M	141_G	1.506	1.00
33_S	37_E	1.504	1.00
158_T	169_D	1.501	1.00
48_C	52_R	1.500	1.00
36_M	99_A	1.498	1.00
14_T	209_I	1.478	1.00
59_H	62_D	1.477	1.00
97_S	100_Q	1.470	1.00
90_S	93_G	1.429	1.00
64_Y	81_E	1.424	1.00
37_E	61_F	1.422	1.00
167_E	171_M	1.398	1.00
211_P	215_T	1.380	1.00
114_M	132_L	1.377	1.00
59_H	81_E	1.348	1.00
178_H	181_N	1.336	1.00
109_A	112_D	1.333	1.00
79_A	88_Y	1.325	1.00
132_L	138_L	1.300	1.00
73_A	78_L	1.295	1.00
174_V	182_Y	1.286	1.00
48_C	85_I	1.277	1.00
112_D	136_H	1.274	1.00
118_T	125_R	1.271	1.00
155_L	206_L	1.246	1.00
52_R	55_A	1.246	1.00
125_R	167_E	1.244	1.00
101_S	119_D	1.231	1.00
14_T	17_D	1.227	1.00
188_A	192_E	1.221	1.00
76_E	79_A	1.204	1.00
45_S	50_D	1.198	1.00
138_L	141_G	1.174	1.00
75_E	93_G	1.168	1.00
152_S	170_L	1.167	1.00
101_S	106_H	1.158	1.00
166_I	170_L	1.145	1.00
157_I	211_P	1.140	1.00
98_A	120_L	1.135	1.00
39_L	43_I	1.130	1.00
171_M	174_V	1.124	1.00
74_D	96_K	1.119	1.00
97_S	101_S	1.117	1.00
55_A	58_E	1.116	1.00
35_R	135_G	1.116	1.00
181_N	185_W	1.107	1.00
102_I	110_V	1.101	1.00
137_D	180_K	1.099	1.00
193_T	205_V	1.095	1.00
19_L	23_H	1.090	1.00
167_E	170_L	1.089	1.00
106_H	116_D	1.084	1.00
18_R	22_Q	1.073	1.00
105_D	116_D	1.067	1.00
117_L	132_L	1.065	1.00
16_I	20_R	1.063	1.00
164_E	167_E	1.060	1.00
70_Y	78_L	1.057	1.00
155_L	209_I	1.049	1.00
201_C	210_C	1.046	1.00
40_V	61_F	1.046	1.00
39_L	131_V	1.042	1.00
49_T	52_R	1.030	1.00
75_E	92_A	1.029	1.00
162_R	165_A	1.025	1.00
57_T	61_F	1.021	1.00
17_D	21_E	1.014	1.00
29_S	192_E	1.010	1.00
15_V	206_L	0.988	1.00
160_K	165_A	0.985	1.00
37_E	57_T	0.977	1.00
36_M	70_Y	0.974	1.00
176_E	179_W	0.971	1.00
132_L	141_G	0.970	1.00
22_Q	205_V	0.957	1.00
70_Y	99_A	0.956	1.00
75_E	100_Q	0.953	1.00
54_N	58_E	0.939	1.00
14_T	18_R	0.937	1.00
189_H	193_T	0.936	1.00
206_L	209_I	0.934	1.00
165_A	169_D	0.917	1.00
194_C	204_C	0.917	1.00
93_G	97_S	0.915	1.00
194_C	201_C	0.912	1.00
51_E	55_A	0.908	1.00
142_I	171_M	0.895	1.00
189_H	205_V	0.893	1.00
98_A	102_I	0.891	1.00
39_L	98_A	0.891	1.00
67_V	103_L	0.890	1.00
140_Q	176_E	0.875	1.00
169_D	172_P	0.874	1.00
98_A	101_S	0.871	1.00
168_T	171_M	0.867	1.00
31_R	58_E	0.866	1.00
42_V	131_V	0.864	1.00
152_S	186_L	0.863	1.00
157_I	215_T	0.863	1.00
18_R	205_V	0.861	1.00
133_Q	143_V	0.860	1.00
23_H	188_A	0.859	1.00
46_A	127_T	0.858	1.00
115_S	118_T	0.856	1.00
32_F	37_E	0.856	1.00
25_D	31_R	0.851	1.00
71_A	99_A	0.850	1.00
77_A	81_E	0.849	1.00
133_Q	183_T	0.844	1.00
182_Y	186_L	0.831	1.00
73_A	77_A	0.828	1.00
114_M	138_L	0.826	1.00
114_M	129_N	0.821	1.00
163_P	167_E	0.820	1.00
211_P	214_K	0.820	1.00
18_R	21_E	0.817	1.00
153_R	166_I	0.813	1.00
59_H	84_S	0.810	1.00
71_A	103_L	0.809	1.00
168_T	172_P	0.807	1.00
37_E	65_E	0.803	1.00
132_L	136_H	0.803	1.00
13_G	17_D	0.798	1.00
133_Q	180_K	0.796	1.00
56_E	59_H	0.793	1.00
40_V	98_A	0.792	1.00
153_R	158_T	0.785	1.00
52_R	84_S	0.784	1.00
143_V	183_T	0.775	1.00
193_T	203_A	0.773	1.00
161_K	165_A	0.772	1.00
16_I	181_N	0.771	1.00
123_V	127_T	0.762	1.00
160_K	166_I	0.761	1.00
32_F	38_L	0.759	1.00
110_V	117_L	0.758	1.00
64_Y	77_A	0.754	1.00
171_M	179_W	0.751	1.00
26_P	188_A	0.746	1.00
67_V	110_V	0.745	1.00
163_P	166_I	0.743	1.00
114_M	128_A	0.742	1.00
59_H	63_T	0.742	1.00
77_A	80_A	0.741	1.00
142_I	179_W	0.738	1.00
38_L	135_G	0.732	1.00
19_L	184_H	0.728	1.00
102_I	108_G	0.720	1.00
149_Q	153_R	0.719	1.00
95_I	99_A	0.715	1.00
129_N	142_I	0.714	1.00
55_A	59_H	0.711	0.99
175_P	179_W	0.708	0.99
42_V	134_H	0.703	0.99
134_H	180_K	0.702	0.99
52_R	85_I	0.699	0.99
17_D	20_R	0.698	0.99
71_A	100_Q	0.691	0.99
68_A	108_G	0.691	0.99
170_L	174_V	0.690	0.99
71_A	74_D	0.687	0.99
201_C	204_C	0.686	0.99
44_L	53_V	0.685	0.99
144_V	166_I	0.679	0.99
151_L	189_H	0.677	0.99
189_H	192_E	0.676	0.99
42_V	127_T	0.673	0.99
165_A	168_T	0.669	0.99
125_R	129_N	0.666	0.99
81_E	84_S	0.660	0.99
133_Q	141_G	0.660	0.99
103_L	106_H	0.653	0.99
199_P	210_C	0.652	0.99
129_N	167_E	0.652	0.99
71_A	96_K	0.644	0.99
141_G	171_M	0.640	0.99
20_R	185_W	0.640	0.99
194_C	210_C	0.629	0.99
92_A	95_I	0.626	0.99
15_V	185_W	0.626	0.99
123_V	128_A	0.625	0.99
64_Y	78_L	0.621	0.99
12_V	173_V	0.620	0.99
141_G	179_W	0.616	0.99
142_I	174_V	0.615	0.99
178_H	185_W	0.613	0.99
92_A	96_K	0.612	0.98
53_V	85_I	0.611	0.98
207_A	212_S	0.610	0.98
44_L	85_I	0.610	0.98
51_E	54_N	0.608	0.98
131_V	135_G	0.608	0.98
65_E	70_Y	0.606	0.98
148_V	186_L	0.606	0.98
154_R	199_P	0.605	0.98
117_L	131_V	0.604	0.98
67_V	99_A	0.604	0.98
119_D	132_L	0.602	0.98
127_T	131_V	0.601	0.98
153_R	160_K	0.600	0.98
162_R	166_I	0.597	0.98
73_A	96_K	0.597	0.98
118_T	128_A	0.594	0.98
37_E	70_Y	0.594	0.98
209_I	213_S	0.594	0.98
23_H	189_H	0.592	0.98
18_R	209_I	0.586	0.98
69_D	72_N	0.586	0.98
78_L	82_L	0.586	0.98
112_D	116_D	0.584	0.98
125_R	164_E	0.582	0.98
43_I	95_I	0.581	0.98
114_M	125_R	0.580	0.98
13_G	178_H	0.580	0.98
153_R	161_K	0.578	0.98
137_D	140_Q	0.578	0.98
123_V	131_V	0.578	0.98
101_S	120_L	0.576	0.98
14_T	208_D	0.575	0.98
34_S	65_E	0.573	0.98
142_I	182_Y	0.573	0.98
16_I	178_H	0.569	0.98
134_H	184_H	0.568	0.98
28_I	134_H	0.567	0.98
109_A	136_H	0.567	0.98
146_T	196_A	0.565	0.97
39_L	102_I	0.563	0.97
113_T	132_L	0.558	0.97
79_A	92_A	0.556	0.97
100_Q	103_L	0.552	0.97
40_V	43_I	0.552	0.97
12_V	175_P	0.551	0.97
154_R	201_C	0.550	0.97
24_P	27_E	0.549	0.97
162_R	167_E	0.548	0.97
129_N	143_V	0.546	0.97
56_E	85_I	0.544	0.97
117_L	123_V	0.543	0.97
149_Q	162_R	0.543	0.97
166_I	174_V	0.542	0.97
195_T	198_N	0.540	0.97
204_C	210_C	0.539	0.97
40_V	99_A	0.537	0.97
167_E	174_V	0.532	0.96
34_S	38_L	0.530	0.96
161_K	166_I	0.529	0.96
207_A	214_K	0.527	0.96
113_T	138_L	0.524	0.96
144_V	148_V	0.522	0.96
41_A	57_T	0.521	0.96
76_E	96_K	0.519	0.96
169_D	173_V	0.519	0.96
13_G	177_D	0.518	0.96
149_Q	163_P	0.513	0.96
144_V	149_Q	0.512	0.96
161_K	171_M	0.511	0.95
129_N	141_G	0.510	0.95
140_Q	180_K	0.510	0.95
19_L	185_W	0.508	0.95
126_K	144_V	0.506	0.95
15_V	155_L	0.504	0.95
126_K	147_H	0.504	0.95
45_S	187_I	0.500	0.95
55_A	84_S	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fspA	1	0.9559	100	0.224	Contact Map
1kg2A	1	0.9604	100	0.234	Contact Map
3n5nX	1	0.9868	100	0.236	Contact Map
2abkA	1	0.9295	100	0.239	Contact Map
4unfA	1	0.9383	100	0.239	Contact Map
1ornA	1	0.9339	100	0.241	Contact Map
1keaA	2	0.9339	100	0.247	Contact Map
4uobA	1	0.9648	100	0.251	Contact Map
1pu6A	1	0.837	100	0.363	Contact Map
3n0uA	1	0.8722	100	0.466	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.