Q9HRP2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRP2 - Uncharacterized protein

UniProt:	Q9HRP2	Sequences: MAGNTDSERRAVLDAETIAVVGCSATPGKPAHEVPAYLDAHGYTVVPVNPYAERVLGHAAADSLAEIDQRVDVVDVFRPREEVPGIVDAAIARDDVGAVWLQVGIQHADAEERAAAAGLRVVSNSCIKVDHQRLVAP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	137 (127)
Sequences:	1893 (1293)
Seq/√Len:	114.7

ECOLI - YCCU
BACSU - YNET
HALSA - Q9HRP2
SULSO - Q97Z29

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_S	66_E	3.538	1.00
88_D	113_R	2.901	1.00
37_Y	131_H	2.395	1.00
44_T	58_H	2.361	1.00
17_T	44_T	2.340	1.00
39_D	58_H	2.288	1.00
112_E	116_A	2.229	1.00
93_R	96_V	2.226	1.00
15_A	73_V	2.206	1.00
61_A	68_D	2.149	1.00
84_P	107_H	2.079	1.00
67_I	71_V	2.066	1.00
65_A	89_A	2.044	1.00
103_V	129_V	2.003	1.00
87_V	99_V	1.998	1.00
62_D	66_E	1.988	1.00
65_A	92_A	1.843	1.00
23_C	35_P	1.829	1.00
36_A	40_A	1.796	1.00
9_R	13_L	1.742	1.00
44_T	69_Q	1.717	1.00
10_R	14_D	1.697	1.00
111_E	123_S	1.697	1.00
83_V	101_L	1.618	1.00
46_V	69_Q	1.584	1.00
11_A	98_A	1.565	1.00
130_D	133_R	1.561	1.00
70_R	97_G	1.560	1.00
17_T	69_Q	1.516	1.00
48_V	67_I	1.466	1.00
87_V	110_A	1.465	1.00
64_L	93_R	1.401	1.00
26_T	29_K	1.379	1.00
54_R	59_A	1.366	1.00
106_Q	124_N	1.344	1.00
84_P	113_R	1.337	1.00
125_S	130_D	1.332	1.00
55_V	60_A	1.283	0.99
82_E	85_G	1.266	0.99
111_E	121_V	1.244	0.99
71_V	93_R	1.244	0.99
85_G	88_D	1.243	0.99
91_I	117_A	1.234	0.99
91_I	113_R	1.227	0.99
15_A	98_A	1.219	0.99
41_H	131_H	1.193	0.99
73_V	127_I	1.182	0.99
108_A	123_S	1.180	0.99
52_A	55_V	1.170	0.99
98_A	120_R	1.166	0.99
76_V	101_L	1.159	0.99
113_R	117_A	1.154	0.99
112_E	115_A	1.136	0.99
33_E	128_K	1.124	0.99
76_V	99_V	1.110	0.98
111_E	115_A	1.108	0.98
20_V	45_V	1.099	0.98
73_V	98_A	1.092	0.98
17_T	46_V	1.082	0.98
79_P	82_E	1.081	0.98
114_A	119_L	1.080	0.98
39_D	56_L	1.053	0.98
15_A	72_D	1.040	0.98
18_I	73_V	1.037	0.98
87_V	114_A	1.035	0.98
30_P	33_E	1.035	0.98
91_I	119_L	1.035	0.98
108_A	112_E	1.028	0.97
18_I	127_I	1.009	0.97
52_A	60_A	1.006	0.97
32_H	36_A	0.997	0.97
24_S	31_A	0.972	0.96
128_K	132_Q	0.971	0.96
103_V	130_D	0.964	0.96
20_V	35_P	0.961	0.96
21_V	74_V	0.961	0.96
99_V	114_A	0.958	0.96
78_R	82_E	0.949	0.96
63_S	89_A	0.949	0.96
30_P	34_V	0.945	0.96
29_K	79_P	0.939	0.96
106_Q	123_S	0.935	0.96
96_V	119_L	0.935	0.96
94_D	119_L	0.928	0.95
39_D	45_V	0.924	0.95
83_V	105_I	0.918	0.95
91_I	96_V	0.902	0.95
75_D	127_I	0.899	0.94
84_P	88_D	0.891	0.94
26_T	51_Y	0.882	0.94
37_Y	128_K	0.871	0.93
10_R	120_R	0.860	0.93
23_C	55_V	0.850	0.93
39_D	44_T	0.842	0.92
77_F	102_Q	0.837	0.92
49_N	52_A	0.836	0.92
7_S	120_R	0.831	0.92
33_E	36_A	0.831	0.92
107_H	113_R	0.822	0.91
107_H	110_A	0.805	0.91
101_L	121_V	0.799	0.90
84_P	109_D	0.795	0.90
53_E	62_D	0.789	0.90
25_A	52_A	0.787	0.89
25_A	55_V	0.786	0.89
7_S	10_R	0.781	0.89
54_R	60_A	0.779	0.89
32_H	56_L	0.768	0.88
18_I	43_Y	0.762	0.88
6_D	9_R	0.759	0.88
90_A	119_L	0.758	0.88
34_V	77_F	0.756	0.88
53_E	59_A	0.755	0.87
25_A	51_Y	0.736	0.86
46_V	67_I	0.729	0.86
88_D	92_A	0.725	0.85
21_V	90_A	0.721	0.85
38_L	127_I	0.707	0.84
54_R	57_G	0.702	0.83
61_A	67_I	0.701	0.83
23_C	45_V	0.689	0.82
21_V	86_I	0.668	0.80
37_Y	41_H	0.668	0.80
10_R	13_L	0.668	0.80
38_L	45_V	0.663	0.80
31_A	35_P	0.662	0.80
90_A	99_V	0.662	0.80
27_P	36_A	0.658	0.79
85_G	89_A	0.657	0.79
24_S	86_I	0.656	0.79
35_P	38_L	0.656	0.79
47_P	60_A	0.652	0.79
28_G	33_E	0.649	0.78
27_P	32_H	0.647	0.78
83_V	107_H	0.647	0.78
7_S	14_D	0.646	0.78
91_I	94_D	0.643	0.78
108_A	111_E	0.641	0.77
14_D	97_G	0.639	0.77
29_K	105_I	0.635	0.77
97_G	120_R	0.627	0.76
35_P	45_V	0.622	0.75
49_N	60_A	0.618	0.75
25_A	32_H	0.616	0.75
34_V	102_Q	0.613	0.74
76_V	83_V	0.613	0.74
45_V	58_H	0.613	0.74
80_R	107_H	0.606	0.73
103_V	128_K	0.606	0.73
87_V	113_R	0.605	0.73
52_A	62_D	0.605	0.73
67_I	93_R	0.600	0.73
47_P	59_A	0.593	0.72
35_P	56_L	0.586	0.71
8_E	125_S	0.576	0.70
23_C	34_V	0.575	0.70
25_A	31_A	0.570	0.69
87_V	91_I	0.568	0.69
101_L	114_A	0.565	0.68
37_Y	132_Q	0.565	0.68
58_H	61_A	0.560	0.68
33_E	132_Q	0.556	0.67
20_V	23_C	0.554	0.67
6_D	10_R	0.552	0.66
103_V	106_Q	0.547	0.66
88_D	91_I	0.542	0.65
75_D	102_Q	0.538	0.64
90_A	96_V	0.538	0.64
76_V	86_I	0.537	0.64
23_C	39_D	0.537	0.64
85_G	107_H	0.535	0.64
87_V	107_H	0.531	0.63
49_N	79_P	0.530	0.63
80_R	105_I	0.523	0.62
109_D	112_E	0.521	0.62
27_P	34_V	0.518	0.62
24_S	29_K	0.517	0.61
33_E	37_Y	0.516	0.61
72_D	97_G	0.514	0.61
11_A	122_V	0.508	0.60
86_I	105_I	0.508	0.60
23_C	60_A	0.507	0.60
11_A	15_A	0.507	0.60
25_A	49_N	0.507	0.60
15_A	127_I	0.504	0.59
24_S	49_N	0.503	0.59
59_A	66_E	0.502	0.59
70_R	93_R	0.501	0.59
83_V	90_A	0.500	0.59
46_V	71_V	0.500	0.59

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ff4A	1	0.8832	99.9	0.479	Contact Map
2csuA	2	0.9343	99.9	0.527	Contact Map
1iukA	1	0.9781	99.9	0.574	Contact Map
2duwA	1	0.9781	99.8	0.578	Contact Map
1y81A	1	0.8467	99.8	0.597	Contact Map
2d59A	1	0.9927	99.8	0.604	Contact Map
3pffA	2	0.8978	99.7	0.636	Contact Map
2fp4A	1	0.9635	99.6	0.673	Contact Map
2yv1A	1	0.9124	99.5	0.682	Contact Map
3mwdB	1	0.9051	99.5	0.682	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.