Q9HRM2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRM2 - Phosphoribosylaminoimidazole carboxylase catalytic subunit

UniProt:	Q9HRM2	Sequences: MTTVSDLIDLFETEAAADHPPDETPDVGVIMGSDSDLDVMAGAHDALTDLGFTELTDYDDPPTGYTFESWVVSAHRTPTLMDAYARTAAARGLDVIIAGAGGKSADLPNMTASLAYPIPVVGVPVQEKSVPSVIGMPTGAPITAVDAGKSYNAGLAAAQFLATDDPTLADRLRDLQAARQEGVADVSARLHSQGTDSLRSPQN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	203 (156)
Sequences:	1678 (849)
Seq/√Len:	68.0

ECOLI - PURE
BACSU - PURE
HALSA - Q9HRM2
SULSO - PURE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_G	84_Y	3.100	1.00
34_D	186_V	2.918	1.00
50_L	158_A	2.442	1.00
89_A	173_R	2.440	1.00
159_Q	176_Q	2.383	1.00
70_W	187_S	2.343	1.00
108_P	133_V	2.340	1.00
52_F	158_A	2.246	1.00
40_M	123_V	2.190	1.00
161_L	168_L	2.173	1.00
26_D	94_D	2.166	1.00
130_V	134_I	2.155	1.00
145_V	156_A	2.103	1.00
29_V	44_H	2.069	1.00
138_T	151_Y	2.014	1.00
162_A	168_L	1.994	1.00
68_E	91_R	1.988	1.00
79_T	86_R	1.960	1.00
30_I	111_T	1.949	1.00
28_G	93_L	1.933	1.00
40_M	99_G	1.887	1.00
89_A	169_A	1.876	1.00
48_T	67_F	1.869	1.00
82_D	114_L	1.746	1.00
80_L	184_A	1.707	1.00
126_Q	148_G	1.706	1.00
94_D	164_D	1.698	1.00
44_H	69_S	1.694	1.00
181_E	185_D	1.674	0.99
158_A	168_L	1.671	0.99
83_A	87_T	1.671	0.99
188_A	192_S	1.663	0.99
72_V	81_M	1.655	0.99
77_T	183_V	1.600	0.99
121_V	145_V	1.597	0.99
87_T	90_A	1.594	0.99
130_V	147_A	1.569	0.99
50_L	171_R	1.556	0.99
41_A	45_D	1.555	0.99
167_T	171_R	1.524	0.99
89_A	117_P	1.523	0.99
41_A	193_Q	1.504	0.99
70_W	80_L	1.490	0.99
117_P	169_A	1.481	0.99
170_D	174_D	1.457	0.98
174_D	178_A	1.428	0.98
42_G	45_D	1.419	0.98
160_F	163_T	1.406	0.98
70_W	191_H	1.392	0.98
27_V	95_V	1.361	0.98
51_G	66_T	1.360	0.98
187_S	191_H	1.346	0.97
46_A	154_G	1.315	0.97
49_D	178_A	1.311	0.97
51_G	171_R	1.306	0.97
134_I	147_A	1.289	0.97
26_D	66_T	1.282	0.97
172_L	176_Q	1.273	0.96
121_V	143_T	1.270	0.96
44_H	67_F	1.269	0.96
81_M	111_T	1.249	0.96
46_A	50_L	1.246	0.96
102_G	128_K	1.228	0.96
155_L	158_A	1.221	0.95
146_D	149_K	1.202	0.95
175_L	179_R	1.199	0.95
177_A	181_E	1.170	0.94
117_P	173_R	1.136	0.93
80_L	187_S	1.131	0.93
138_T	149_K	1.123	0.93
84_Y	93_L	1.095	0.92
81_M	110_M	1.084	0.92
117_P	172_L	1.083	0.92
180_Q	184_A	1.069	0.91
185_D	188_A	1.062	0.91
85_A	96_I	1.047	0.90
102_G	129_S	1.042	0.90
79_T	83_A	1.034	0.90
182_G	186_V	1.030	0.89
185_D	189_R	1.024	0.89
155_L	176_Q	1.016	0.89
96_I	118_I	1.002	0.88
40_M	150_S	0.994	0.88
178_A	182_G	0.994	0.88
39_V	148_G	0.991	0.88
77_T	80_L	0.978	0.87
42_G	151_Y	0.965	0.86
72_V	110_M	0.963	0.86
80_L	183_V	0.954	0.85
46_A	49_D	0.944	0.85
34_D	189_R	0.936	0.84
177_A	180_Q	0.933	0.84
46_A	155_L	0.929	0.84
173_R	177_A	0.927	0.84
122_G	133_V	0.919	0.83
99_G	123_V	0.911	0.83
151_Y	175_L	0.902	0.82
94_D	165_D	0.900	0.82
183_V	187_S	0.897	0.82
79_T	180_Q	0.886	0.81
44_H	48_T	0.885	0.81
150_S	154_G	0.877	0.80
178_A	181_E	0.876	0.80
85_A	88_A	0.870	0.80
94_D	163_T	0.859	0.79
81_M	85_A	0.845	0.78
94_D	169_A	0.829	0.76
25_P	66_T	0.828	0.76
30_I	77_T	0.823	0.76
68_E	93_L	0.821	0.76
37_L	69_S	0.820	0.76
85_A	111_T	0.819	0.76
95_V	161_L	0.813	0.75
78_P	113_S	0.810	0.75
25_P	94_D	0.803	0.74
68_E	84_Y	0.801	0.74
179_R	182_G	0.797	0.74
39_V	42_G	0.783	0.72
86_R	114_L	0.780	0.72
39_V	125_V	0.774	0.71
87_T	91_R	0.772	0.71
129_S	132_S	0.767	0.71
146_D	159_Q	0.766	0.71
30_I	96_I	0.763	0.70
45_D	48_T	0.759	0.70
46_A	151_Y	0.759	0.70
29_V	69_S	0.752	0.69
38_D	41_A	0.751	0.69
37_L	71_V	0.745	0.68
98_A	133_V	0.743	0.68
176_Q	179_R	0.738	0.68
154_G	158_A	0.737	0.68
138_T	146_D	0.735	0.67
28_G	68_E	0.733	0.67
89_A	162_A	0.729	0.67
43_A	99_G	0.727	0.67
99_G	154_G	0.724	0.66
127_E	146_D	0.723	0.66
102_G	138_T	0.715	0.65
45_D	49_D	0.715	0.65
158_A	161_L	0.711	0.65
168_L	172_L	0.710	0.65
49_D	151_Y	0.709	0.65
88_A	96_I	0.705	0.64
50_L	175_L	0.704	0.64
131_P	140_A	0.693	0.63
80_L	191_H	0.693	0.63
158_A	172_L	0.689	0.62
131_P	150_S	0.687	0.62
169_A	173_R	0.686	0.62
167_T	170_D	0.677	0.61
127_E	131_P	0.676	0.61
95_V	160_F	0.672	0.60
52_F	168_L	0.672	0.60
79_T	82_D	0.671	0.60
189_R	193_Q	0.670	0.60
181_E	184_A	0.669	0.60
90_A	170_D	0.661	0.59
98_A	108_P	0.658	0.59
140_A	176_Q	0.655	0.58
186_V	189_R	0.650	0.58
72_V	80_L	0.649	0.58
28_G	96_I	0.646	0.57
94_D	161_L	0.645	0.57
165_D	170_D	0.639	0.57
162_A	169_A	0.638	0.56
31_M	40_M	0.637	0.56
28_G	91_R	0.630	0.56
49_D	171_R	0.629	0.55
37_L	44_H	0.628	0.55
42_G	150_S	0.627	0.55
110_M	113_S	0.624	0.55
182_G	185_D	0.624	0.55
81_M	108_P	0.622	0.55
39_V	126_Q	0.619	0.54
143_T	156_A	0.614	0.54
46_A	175_L	0.613	0.54
85_A	114_L	0.610	0.53
189_R	192_S	0.610	0.53
41_A	48_T	0.606	0.53
102_G	110_M	0.602	0.52
170_D	173_R	0.592	0.51
72_V	132_S	0.592	0.51
82_D	86_R	0.591	0.51
26_D	165_D	0.589	0.51
108_P	122_G	0.586	0.50
72_V	102_G	0.581	0.50
93_L	118_I	0.579	0.49
162_A	176_Q	0.579	0.49
166_P	169_A	0.576	0.49
102_G	127_E	0.570	0.48
158_A	171_R	0.566	0.48
37_L	193_Q	0.561	0.47
71_V	125_V	0.561	0.47
77_T	187_S	0.558	0.47
81_M	133_V	0.558	0.47
30_I	84_Y	0.555	0.47
30_I	81_M	0.554	0.46
83_A	177_A	0.554	0.46
114_L	146_D	0.551	0.46
140_A	172_L	0.549	0.46
81_M	129_S	0.540	0.45
110_M	132_S	0.540	0.45
82_D	132_S	0.537	0.44
113_S	123_V	0.536	0.44
126_Q	149_K	0.535	0.44
102_G	108_P	0.534	0.44
99_G	125_V	0.533	0.44
111_T	115_A	0.532	0.44
71_V	193_Q	0.531	0.44
34_D	145_V	0.531	0.44
30_I	72_V	0.531	0.44
110_M	133_V	0.529	0.44
102_G	125_V	0.524	0.43
111_T	114_L	0.519	0.42
40_M	128_K	0.518	0.42
51_G	167_T	0.518	0.42
93_L	96_I	0.514	0.42
166_P	170_D	0.512	0.42
138_T	154_G	0.511	0.41
89_A	170_D	0.510	0.41
84_Y	96_I	0.509	0.41
85_A	118_I	0.509	0.41
151_Y	182_G	0.508	0.41
71_V	186_V	0.505	0.41
66_T	86_R	0.505	0.41
121_V	157_A	0.504	0.41
128_K	148_G	0.503	0.40
131_P	193_Q	0.502	0.40
24_T	177_A	0.501	0.40
151_Y	179_R	0.501	0.40
66_T	171_R	0.501	0.40
79_T	114_L	0.501	0.40
46_A	71_V	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1o4vA	5	0.803	100	0.318	Contact Map
3lp6A	5	0.8227	100	0.329	Contact Map
3trhA	5	0.7734	100	0.338	Contact Map
3orsA	5	0.7537	100	0.344	Contact Map
4ja0A	6	0.8522	100	0.346	Contact Map
4grdA	5	0.7882	100	0.348	Contact Map
1u11A	6	0.7635	100	0.35	Contact Map
2h31A	6	0.8768	100	0.351	Contact Map
3oowA	5	0.7586	100	0.351	Contact Map
4ay3A	2	0.7537	100	0.355	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.