Q9HRL7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRL7 - NADH dehydrogenase/oxidoreductase-like protein

UniProt:	Q9HRL7	Sequences: MIGLLKSMATTMKHALSGDTFTVEYPEEAPEVSARFRGVHKFSQERCIWCRQCENVCPNDTIQIVTDNQRNGEQYNLHVGQCIYCRLCEEVCPVDAILLTENFEFTGDTKHDLVFNKEQLKNVPWYNDIDPVASREPDRGAWIGDGEGEVDYQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	153 (124)
Sequences:	1443 (638)
Seq/√Len:	57.3

ECOLI - NUOI HYFH HYCF
HALSA - Q9HRL7
SULSO - Q980H1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_E	99_L	4.879	1.00
56_V	91_V	4.085	1.00
109_T	112_D	3.243	1.00
48_I	94_V	2.991	1.00
7_S	11_T	2.822	1.00
6_K	9_A	2.429	1.00
89_E	97_I	2.235	1.00
29_A	104_E	2.152	1.00
12_M	15_A	2.145	1.00
65_V	74_Q	2.054	1.00
59_N	83_I	2.009	1.00
24_E	28_E	1.986	1.00
49_W	66_T	1.920	1.00
23_V	30_P	1.839	0.99
32_V	103_F	1.801	0.99
42_F	97_I	1.760	0.99
4_L	8_M	1.751	0.99
116_N	119_Q	1.666	0.99
15_A	20_T	1.597	0.99
80_G	113_L	1.585	0.98
14_H	17_S	1.576	0.98
39_V	102_N	1.557	0.98
51_R	64_I	1.554	0.98
54_E	63_Q	1.523	0.98
40_H	79_V	1.514	0.98
24_E	27_E	1.511	0.98
52_Q	56_V	1.507	0.98
29_A	103_F	1.486	0.98
115_F	119_Q	1.478	0.98
48_I	51_R	1.441	0.97
7_S	10_T	1.399	0.97
51_R	55_N	1.389	0.96
3_G	6_K	1.388	0.96
5_L	9_A	1.384	0.96
41_K	98_L	1.383	0.96
72_G	75_Y	1.382	0.96
8_M	11_T	1.348	0.96
13_K	17_S	1.338	0.96
107_G	113_L	1.333	0.95
46_R	96_A	1.322	0.95
104_E	113_L	1.316	0.95
48_I	98_L	1.316	0.95
9_A	13_K	1.308	0.95
49_W	72_G	1.304	0.95
117_K	121_K	1.264	0.94
45_E	117_K	1.260	0.94
34_A	101_E	1.237	0.93
59_N	75_Y	1.200	0.92
81_Q	99_L	1.190	0.92
62_I	78_H	1.172	0.91
42_F	96_A	1.141	0.90
51_R	94_V	1.121	0.89
42_F	120_L	1.110	0.89
64_I	75_Y	1.105	0.89
25_Y	104_E	1.075	0.87
45_E	94_V	1.074	0.87
9_A	12_M	1.040	0.85
88_C	92_C	1.020	0.84
17_S	34_A	1.019	0.84
48_I	75_Y	1.015	0.84
75_Y	117_K	1.003	0.83
4_L	7_S	1.002	0.83
79_V	115_F	1.001	0.83
42_F	117_K	0.994	0.83
52_Q	91_V	0.993	0.83
66_T	70_R	0.984	0.82
43_S	46_R	0.977	0.82
12_M	16_L	0.967	0.81
51_R	54_E	0.938	0.79
115_F	122_N	0.938	0.79
119_Q	122_N	0.925	0.78
107_G	112_D	0.924	0.78
123_V	127_N	0.918	0.77
5_L	108_D	0.905	0.76
79_V	84_Y	0.905	0.76
21_F	24_E	0.903	0.76
56_V	87_L	0.901	0.76
82_C	88_C	0.901	0.76
52_Q	81_Q	0.893	0.75
65_V	73_E	0.893	0.75
54_E	62_I	0.892	0.75
63_Q	74_Q	0.885	0.75
91_V	96_A	0.882	0.74
106_T	109_T	0.870	0.73
77_L	99_L	0.868	0.73
69_Q	80_G	0.840	0.71
76_N	116_N	0.836	0.70
40_H	87_L	0.814	0.68
24_E	29_A	0.805	0.67
3_G	83_I	0.804	0.67
6_K	12_M	0.798	0.67
19_D	31_E	0.780	0.65
39_V	84_Y	0.773	0.64
61_T	83_I	0.767	0.64
85_C	88_C	0.754	0.62
79_V	97_I	0.751	0.62
52_Q	55_N	0.743	0.61
71_N	106_T	0.742	0.61
48_I	68_N	0.739	0.61
30_P	103_F	0.737	0.61
83_I	87_L	0.737	0.61
55_N	89_E	0.726	0.59
50_C	53_C	0.726	0.59
47_C	53_C	0.724	0.59
53_C	57_C	0.724	0.59
50_C	57_C	0.723	0.59
47_C	50_C	0.723	0.59
47_C	57_C	0.721	0.59
44_Q	96_A	0.719	0.59
5_L	111_H	0.713	0.58
53_C	82_C	0.708	0.58
40_H	100_T	0.704	0.57
64_I	76_N	0.698	0.56
67_D	123_V	0.697	0.56
20_T	103_F	0.696	0.56
53_C	85_C	0.691	0.56
50_C	85_C	0.691	0.56
54_E	64_I	0.690	0.56
47_C	85_C	0.689	0.55
57_C	85_C	0.689	0.55
41_K	100_T	0.688	0.55
53_C	92_C	0.672	0.54
103_F	106_T	0.664	0.53
55_N	70_R	0.664	0.53
23_V	56_V	0.648	0.51
32_V	36_F	0.643	0.50
111_H	114_V	0.639	0.50
50_C	82_C	0.636	0.50
16_L	19_D	0.636	0.50
47_C	82_C	0.634	0.49
57_C	82_C	0.634	0.49
43_S	66_T	0.633	0.49
78_H	81_Q	0.631	0.49
105_F	112_D	0.629	0.49
5_L	13_K	0.627	0.49
40_H	77_L	0.616	0.48
17_S	20_T	0.614	0.47
42_F	52_Q	0.614	0.47
6_K	15_A	0.610	0.47
61_T	97_I	0.606	0.46
61_T	72_G	0.605	0.46
14_H	23_V	0.602	0.46
50_C	92_C	0.600	0.46
82_C	85_C	0.599	0.46
57_C	92_C	0.599	0.46
47_C	92_C	0.599	0.46
49_W	67_D	0.586	0.44
9_A	17_S	0.586	0.44
11_T	21_F	0.581	0.44
29_A	34_A	0.576	0.43
89_E	98_L	0.565	0.42
82_C	92_C	0.564	0.42
22_T	26_P	0.561	0.42
33_S	84_Y	0.561	0.42
21_F	108_D	0.560	0.41
85_C	92_C	0.560	0.41
54_E	108_D	0.557	0.41
61_T	86_R	0.554	0.41
6_K	23_V	0.552	0.41
96_A	125_W	0.551	0.40
80_G	110_K	0.550	0.40
33_S	101_E	0.545	0.40
103_F	113_L	0.542	0.40
87_L	91_V	0.535	0.39
41_K	124_P	0.534	0.39
7_S	75_Y	0.531	0.38
63_Q	76_N	0.531	0.38
84_Y	105_F	0.530	0.38
112_D	116_N	0.530	0.38
83_I	90_E	0.530	0.38
41_K	122_N	0.529	0.38
31_E	74_Q	0.525	0.38
48_I	96_A	0.519	0.37
55_N	91_V	0.517	0.37
65_V	71_N	0.516	0.37
77_L	81_Q	0.514	0.37
53_C	88_C	0.513	0.37
50_C	88_C	0.513	0.37
57_C	88_C	0.511	0.36
47_C	88_C	0.511	0.36
46_R	89_E	0.510	0.36
6_K	14_H	0.507	0.36
28_E	33_S	0.506	0.36
48_I	52_Q	0.504	0.36
75_Y	80_G	0.503	0.36
46_R	98_L	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i9v9	1	0.8431	99.9	0.509	Contact Map
1gteA	4	0.6928	99.5	0.678	Contact Map
1xerA	2	0.6471	99.5	0.684	Contact Map
5c4iB	1	0.6536	99.5	0.687	Contact Map
3i9v3	1	0.8954	99.5	0.689	Contact Map
2gmhA	1	0.7386	99.4	0.7	Contact Map
1hfeL	2	0.8497	99.4	0.701	Contact Map
2c42A	2	0.9935	99.4	0.707	Contact Map
4omfG	2	0.6601	99.4	0.709	Contact Map
1jb0C	1	0.5098	99.4	0.71	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.