Q9HRL4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRL4 - NADH dehydrogenase/oxidoreductase-like protein

UniProt:	Q9HRL4	Sequences: MVPMEYYLLLSAAVFCIGVFGVLTRRSALLFLMSVELMLNAAGINLVAFSWFHGNLSGQAFTLFVMALAAAEVAVGLGIILTLYRNFDDIDVTNATTMRW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	100 (96)
Sequences:	1568 (746)
Seq/√Len:	76.2

ECOLI - NUOK
HALSA - Q9HRL4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_G	34_S	5.946	1.00
4_M	52_F	2.836	1.00
89_D	94_N	2.629	1.00
32_L	45_N	2.472	1.00
43_G	65_V	2.415	1.00
4_M	48_A	2.415	1.00
46_L	61_F	2.208	1.00
15_F	38_M	2.146	1.00
45_N	49_F	2.137	1.00
9_L	13_A	2.006	1.00
91_D	94_N	1.989	1.00
42_A	45_N	1.943	1.00
7_Y	48_A	1.878	1.00
31_F	92_V	1.789	1.00
19_V	38_M	1.719	1.00
30_L	33_M	1.697	1.00
45_N	48_A	1.695	1.00
83_L	95_A	1.695	1.00
87_F	97_T	1.641	1.00
24_T	40_N	1.622	1.00
20_F	24_T	1.615	1.00
11_S	45_N	1.594	0.99
10_L	14_V	1.568	0.99
40_N	66_M	1.564	0.99
4_M	53_H	1.496	0.99
23_L	30_L	1.471	0.99
46_L	58_G	1.442	0.99
20_F	77_L	1.427	0.99
40_N	83_L	1.427	0.99
82_T	85_R	1.329	0.98
19_V	22_V	1.328	0.98
62_T	66_M	1.303	0.98
50_S	56_L	1.255	0.97
8_L	45_N	1.217	0.97
28_A	92_V	1.197	0.96
22_V	34_S	1.191	0.96
89_D	96_T	1.151	0.95
10_L	44_I	1.138	0.95
75_V	82_T	1.101	0.94
8_L	12_A	1.055	0.93
11_S	56_L	1.044	0.92
63_L	67_A	1.040	0.92
18_G	31_F	1.037	0.92
32_L	80_I	1.020	0.92
28_A	35_V	1.014	0.91
69_A	76_G	0.950	0.88
22_V	38_M	0.949	0.88
74_A	79_I	0.947	0.88
14_V	77_L	0.946	0.88
20_F	66_M	0.934	0.88
19_V	84_Y	0.931	0.87
46_L	90_I	0.921	0.87
22_V	31_F	0.915	0.86
37_L	49_F	0.912	0.86
40_N	43_G	0.910	0.86
13_A	17_I	0.906	0.86
40_N	73_V	0.887	0.85
43_G	62_T	0.884	0.84
8_L	49_F	0.879	0.84
26_R	66_M	0.876	0.84
92_V	95_A	0.864	0.83
18_G	38_M	0.851	0.82
11_S	15_F	0.829	0.80
45_N	62_T	0.820	0.80
11_S	41_A	0.818	0.80
41_A	44_I	0.817	0.79
54_G	95_A	0.790	0.77
10_L	48_A	0.787	0.77
28_A	73_V	0.787	0.77
30_L	79_I	0.777	0.76
22_V	66_M	0.775	0.76
50_S	81_L	0.764	0.75
7_Y	79_I	0.756	0.74
44_I	48_A	0.752	0.74
10_L	63_L	0.741	0.73
17_I	21_G	0.739	0.72
16_C	20_F	0.731	0.71
6_Y	9_L	0.728	0.71
95_A	98_M	0.726	0.71
50_S	60_A	0.719	0.70
6_Y	10_L	0.718	0.70
46_L	59_Q	0.713	0.70
87_F	95_A	0.703	0.69
76_G	87_F	0.702	0.68
32_L	71_A	0.702	0.68
38_M	76_G	0.688	0.67
35_V	78_G	0.686	0.67
78_G	82_T	0.684	0.66
78_G	96_T	0.674	0.65
14_V	32_L	0.652	0.63
12_A	16_C	0.651	0.63
25_R	57_S	0.649	0.62
30_L	73_V	0.644	0.62
69_A	73_V	0.643	0.62
64_F	99_R	0.639	0.61
33_M	65_V	0.633	0.60
25_R	30_L	0.627	0.60
27_S	90_I	0.620	0.59
26_R	93_T	0.615	0.58
24_T	63_L	0.614	0.58
7_Y	67_A	0.613	0.58
64_F	67_A	0.608	0.57
87_F	94_N	0.606	0.57
52_F	65_V	0.605	0.57
11_S	29_L	0.602	0.57
62_T	91_D	0.602	0.57
18_G	34_S	0.598	0.56
64_F	70_A	0.597	0.56
9_L	12_A	0.591	0.55
43_G	49_F	0.590	0.55
66_M	82_T	0.588	0.55
21_G	67_A	0.587	0.55
51_W	82_T	0.582	0.54
26_R	85_R	0.582	0.54
26_R	63_L	0.577	0.53
49_F	71_A	0.576	0.53
34_S	63_L	0.571	0.53
37_L	71_A	0.561	0.51
29_L	95_A	0.558	0.51
21_G	53_H	0.558	0.51
42_A	53_H	0.555	0.51
30_L	50_S	0.555	0.51
8_L	52_F	0.555	0.51
14_V	17_I	0.554	0.51
58_G	61_F	0.547	0.50
27_S	58_G	0.547	0.50
72_E	75_V	0.545	0.49
28_A	93_T	0.543	0.49
67_A	82_T	0.542	0.49
11_S	44_I	0.542	0.49
73_V	80_I	0.542	0.49
31_F	42_A	0.539	0.49
18_G	40_N	0.539	0.49
78_G	86_N	0.537	0.48
20_F	63_L	0.534	0.48
6_Y	98_M	0.532	0.48
57_S	97_T	0.518	0.46
12_A	73_V	0.513	0.45
11_S	17_I	0.512	0.45
27_S	33_M	0.510	0.45
47_V	93_T	0.504	0.44
37_L	85_R	0.504	0.44
26_R	91_D	0.503	0.44
14_V	47_V	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rkoK	1	1	99.9	0.366	Contact Map
4he8K	1	0.95	99.9	0.438	Contact Map
4he8M	1	0.96	8.6	0.935	Contact Map
3rkoN	1	0.95	7.5	0.936	Contact Map
3rkoL	1	0.96	6.1	0.939	Contact Map
3rkoM	1	0.99	5.7	0.94	Contact Map
4cz8A	2	0.87	5.3	0.941	Contact Map
4he8N	1	0.94	4.7	0.942	Contact Map
3mpyA	5	0.8	4.5	0.943	Contact Map
4he8L	1	0.95	4.1	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.