Q9HRI9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRI9 - Uncharacterized protein

UniProt:	Q9HRI9	Sequences: MSDRVRDDGYDDAIDALAADEGYYLACPDGHGSLPPRHACPHCGARELTETALPETGTIDSCSTLHVATPAFADDAPYVLAVASFGAVRLTGQVRAEPGTVEIGDEVAATVGESATTGDRLVVFELR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (110)
Sequences:	2174 (1449)
Seq/√Len:	138.1

HALSA - Q9HRI9
SULSO - Q97UW9 Q7LXW3 Q97UA6 Q97VJ8 Q97WQ4 Q97WQ5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_E	52_A	3.386	1.00
40_C	43_C	3.069	1.00
26_A	51_T	2.754	1.00
27_C	43_C	2.689	1.00
29_D	47_E	2.658	1.00
59_I	107_V	2.543	1.00
27_C	40_C	2.516	1.00
28_P	49_T	2.482	1.00
86_G	106_E	2.407	1.00
11_D	15_D	2.299	1.00
57_G	107_V	2.298	1.00
56_T	86_G	2.283	1.00
84_S	89_R	2.211	1.00
16_A	23_Y	2.178	1.00
20_D	113_E	1.916	1.00
59_I	101_V	1.908	1.00
33_S	41_P	1.857	1.00
59_I	81_A	1.849	1.00
56_T	108_A	1.790	1.00
31_H	42_H	1.779	1.00
24_Y	53_L	1.732	1.00
28_P	47_E	1.704	1.00
25_L	33_S	1.656	1.00
55_E	87_A	1.617	1.00
83_A	92_G	1.512	1.00
12_D	50_E	1.503	1.00
58_T	106_E	1.478	1.00
23_Y	52_A	1.475	1.00
33_S	48_L	1.457	1.00
81_A	94_V	1.431	1.00
58_T	84_S	1.406	1.00
26_A	32_G	1.403	1.00
20_D	111_V	1.361	1.00
62_C	103_I	1.329	1.00
54_P	87_A	1.295	1.00
96_A	105_D	1.281	1.00
25_L	48_L	1.274	1.00
54_P	86_G	1.268	1.00
32_G	51_T	1.265	1.00
60_D	84_S	1.255	1.00
56_T	106_E	1.241	1.00
15_D	19_A	1.204	1.00
64_T	79_V	1.178	1.00
115_A	118_G	1.135	0.99
57_G	83_A	1.127	0.99
17_L	111_V	1.093	0.99
97_E	100_T	1.087	0.99
24_Y	88_V	1.078	0.99
62_C	101_V	1.069	0.99
61_S	82_V	1.050	0.99
58_T	104_G	1.038	0.99
94_V	101_V	0.996	0.98
10_Y	14_I	0.969	0.98
81_A	92_G	0.966	0.98
98_P	101_V	0.963	0.98
65_L	69_T	0.945	0.98
64_T	98_P	0.938	0.97
96_A	100_T	0.929	0.97
39_A	46_R	0.924	0.97
18_A	120_R	0.917	0.97
20_D	120_R	0.892	0.97
65_L	78_Y	0.892	0.97
45_A	48_L	0.886	0.96
102_E	105_D	0.882	0.96
59_I	105_D	0.879	0.96
12_D	16_A	0.879	0.96
32_G	53_L	0.877	0.96
26_A	49_T	0.873	0.96
13_A	17_L	0.862	0.96
16_A	19_A	0.857	0.96
39_A	44_G	0.856	0.96
16_A	21_E	0.845	0.95
29_D	45_A	0.838	0.95
60_D	89_R	0.835	0.95
66_H	77_P	0.833	0.95
113_E	118_G	0.824	0.95
33_S	37_R	0.811	0.94
9_G	38_H	0.810	0.94
26_A	30_G	0.807	0.94
85_F	88_V	0.801	0.94
82_V	91_T	0.798	0.94
115_A	120_R	0.793	0.94
115_A	119_D	0.781	0.93
13_A	16_A	0.775	0.93
12_D	15_D	0.773	0.93
18_A	118_G	0.763	0.92
19_A	23_Y	0.759	0.92
62_C	79_V	0.752	0.92
63_S	80_L	0.750	0.92
82_V	89_R	0.730	0.90
24_Y	32_G	0.718	0.90
53_L	88_V	0.718	0.90
78_Y	93_Q	0.714	0.89
100_T	105_D	0.710	0.89
22_G	53_L	0.708	0.89
79_V	101_V	0.705	0.89
37_R	41_P	0.705	0.89
53_L	85_F	0.705	0.89
9_G	32_G	0.704	0.89
95_R	110_T	0.690	0.88
25_L	34_L	0.687	0.88
84_S	88_V	0.674	0.87
95_R	112_G	0.674	0.87
17_L	109_A	0.668	0.86
31_H	41_P	0.665	0.86
101_V	107_V	0.656	0.85
62_C	94_V	0.647	0.84
73_A	76_A	0.642	0.84
22_G	34_L	0.627	0.82
42_H	76_A	0.617	0.81
24_Y	85_F	0.612	0.81
79_V	96_A	0.611	0.81
57_G	92_G	0.611	0.81
83_A	107_V	0.609	0.81
24_Y	51_T	0.607	0.80
17_L	90_L	0.606	0.80
25_L	50_E	0.606	0.80
27_C	45_A	0.604	0.80
68_A	77_P	0.603	0.80
9_G	63_S	0.601	0.80
31_H	90_L	0.599	0.79
40_C	45_A	0.588	0.78
57_G	90_L	0.584	0.78
17_L	120_R	0.581	0.77
79_V	94_V	0.579	0.77
69_T	76_A	0.578	0.77
39_A	48_L	0.575	0.77
54_P	109_A	0.570	0.76
113_E	120_R	0.568	0.76
35_P	88_V	0.566	0.76
62_C	105_D	0.562	0.75
32_G	87_A	0.557	0.74
63_S	66_H	0.556	0.74
25_L	121_L	0.552	0.74
53_L	91_T	0.551	0.74
18_A	119_D	0.544	0.73
48_L	59_I	0.543	0.73
36_P	50_E	0.538	0.72
30_G	51_T	0.538	0.72
34_L	90_L	0.535	0.71
37_R	50_E	0.534	0.71
68_A	76_A	0.532	0.71
18_A	56_T	0.530	0.71
65_L	72_F	0.529	0.71
36_P	69_T	0.527	0.70
112_G	121_L	0.527	0.70
22_G	77_P	0.525	0.70
112_G	115_A	0.524	0.70
38_H	62_C	0.524	0.70
48_L	82_V	0.524	0.70
59_I	103_I	0.522	0.70
30_G	43_C	0.517	0.69
34_L	88_V	0.512	0.68
44_G	76_A	0.512	0.68
24_Y	34_L	0.512	0.68
10_Y	34_L	0.511	0.68
10_Y	109_A	0.509	0.68
82_V	92_G	0.507	0.67
41_P	67_V	0.507	0.67
79_V	98_P	0.506	0.67
69_T	90_L	0.504	0.67
22_G	109_A	0.504	0.67
53_L	87_A	0.503	0.67
13_A	75_D	0.501	0.66
19_A	52_A	0.500	0.66

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3irbA	3	0.9291	100	0.303	Contact Map
3qcpA	1	0.622	39.6	0.917	Contact Map
3t58A	1	0.5669	36.4	0.919	Contact Map
3llkA	1	0.5591	27.6	0.924	Contact Map
2lcqA	1	0.4252	22.1	0.927	Contact Map
3h0gL	1	0.3228	21.7	0.927	Contact Map
2kdxA	1	0.5118	21.4	0.928	Contact Map
4egvA	1	0.8346	13.7	0.934	Contact Map
1zud1	2	0.3307	11.7	0.936	Contact Map
2d7eA	4	0.4094	11.1	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.