Q9HRH5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRH5 - Endonuclease III

UniProt:	Q9HRH5	Sequences: MQPGTYTLLVALDDAPSITFGAAGTRSLDAGWYAYTGSAFGPGGLTRVQRHRELAAGERDARHWHIDYLLGHPAASVDAVYATTHDDVECATARLLADDATPVPGLGASDCTCETHLVFAPTRDALAQRLAEIHDTSL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (116)
Sequences:	300 (261)
Seq/√Len:	24.2

HALSA - Q9HRH5
SULSO - Q97U25

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_C	113_C	4.875	1.00
90_C	111_C	4.561	1.00
10_V	70_L	4.124	1.00
7_T	34_A	4.088	1.00
93_A	118_V	3.846	1.00
41_G	44_G	2.850	0.99
7_T	36_T	2.346	0.98
41_G	45_L	2.260	0.97
36_T	118_V	2.084	0.96
62_R	71_G	2.076	0.95
21_G	24_G	2.046	0.95
8_L	66_I	2.044	0.95
20_F	24_G	2.034	0.95
113_C	116_H	2.016	0.95
15_A	30_A	1.999	0.94
106_L	117_L	1.916	0.93
24_G	28_L	1.898	0.93
12_L	16_P	1.844	0.92
111_C	116_H	1.822	0.91
66_I	70_L	1.784	0.90
49_Q	53_E	1.753	0.89
20_F	23_A	1.735	0.89
21_G	28_L	1.634	0.86
40_F	44_G	1.602	0.84
12_L	28_L	1.579	0.84
8_L	70_L	1.565	0.83
20_F	28_L	1.506	0.81
21_G	68_Y	1.443	0.78
53_E	59_R	1.435	0.77
90_C	116_H	1.426	0.77
5_T	40_F	1.417	0.76
15_A	27_S	1.355	0.73
40_F	87_D	1.317	0.71
69_L	117_L	1.289	0.69
92_T	100_A	1.229	0.65
19_T	22_A	1.196	0.63
96_L	118_V	1.190	0.63
40_F	43_G	1.166	0.61
23_A	105_G	1.151	0.60
4_G	40_F	1.117	0.58
50_R	90_C	1.108	0.57
9_L	32_W	1.085	0.55
22_A	101_T	1.076	0.55
76_S	79_A	1.064	0.54
13_D	33_Y	1.051	0.53
17_S	25_T	1.029	0.51
52_R	79_A	1.018	0.51
20_F	26_R	1.006	0.50
102_P	108_A	0.983	0.48
23_A	28_L	0.979	0.48
23_A	108_A	0.975	0.48
29_D	102_P	0.971	0.47
106_L	115_T	0.971	0.47
36_T	93_A	0.967	0.47
14_D	92_T	0.932	0.45
30_A	94_R	0.916	0.43
5_T	92_T	0.911	0.43
3_P	96_L	0.898	0.42
11_A	32_W	0.886	0.41
3_P	41_G	0.868	0.40
104_P	108_A	0.867	0.40
21_G	113_C	0.858	0.39
13_D	16_P	0.858	0.39
36_T	40_F	0.855	0.39
23_A	26_R	0.854	0.39
49_Q	72_H	0.837	0.38
4_G	43_G	0.824	0.37
23_A	109_S	0.823	0.37
7_T	83_T	0.823	0.37
11_A	104_P	0.821	0.37
26_R	103_V	0.812	0.36
59_R	92_T	0.798	0.35
98_D	102_P	0.795	0.35
48_V	68_Y	0.793	0.35
88_V	92_T	0.788	0.35
76_S	95_L	0.781	0.34
5_T	8_L	0.781	0.34
14_D	94_R	0.774	0.34
16_P	72_H	0.774	0.34
74_A	77_V	0.772	0.34
9_L	16_P	0.769	0.34
21_G	109_S	0.760	0.33
8_L	39_A	0.760	0.33
52_R	70_L	0.755	0.33
83_T	116_H	0.754	0.33
11_A	78_D	0.746	0.32
45_L	48_V	0.743	0.32
86_D	98_D	0.740	0.32
10_V	66_I	0.737	0.32
4_G	41_G	0.735	0.31
12_L	72_H	0.731	0.31
76_S	80_V	0.730	0.31
9_L	18_I	0.725	0.31
32_W	120_A	0.723	0.31
77_V	108_A	0.722	0.31
39_A	44_G	0.717	0.30
48_V	105_G	0.716	0.30
36_T	96_L	0.715	0.30
69_L	105_G	0.714	0.30
24_G	68_Y	0.712	0.30
21_G	111_C	0.706	0.30
24_G	109_S	0.698	0.29
101_T	108_A	0.696	0.29
41_G	63_H	0.694	0.29
28_L	68_Y	0.693	0.29
5_T	36_T	0.691	0.29
3_P	13_D	0.687	0.29
93_A	116_H	0.686	0.29
3_P	43_G	0.685	0.28
73_P	80_V	0.680	0.28
14_D	114_E	0.679	0.28
20_F	68_Y	0.652	0.27
36_T	70_L	0.649	0.26
19_T	112_T	0.646	0.26
49_Q	85_H	0.645	0.26
7_T	96_L	0.640	0.26
4_G	44_G	0.640	0.26
45_L	120_A	0.640	0.26
39_A	58_E	0.637	0.26
8_L	48_V	0.636	0.26
13_D	95_L	0.635	0.26
7_T	16_P	0.633	0.26
10_V	90_C	0.624	0.25
5_T	87_D	0.617	0.25
58_E	63_H	0.612	0.24
80_V	92_T	0.612	0.24
21_G	116_H	0.612	0.24
20_F	95_L	0.609	0.24
34_A	120_A	0.605	0.24
36_T	94_R	0.595	0.24
13_D	74_A	0.593	0.23
10_V	124_D	0.592	0.23
28_L	90_C	0.588	0.23
28_L	116_H	0.585	0.23
96_L	102_P	0.575	0.23
13_D	76_S	0.574	0.22
85_H	96_L	0.574	0.22
46_T	109_S	0.569	0.22
84_T	88_V	0.565	0.22
50_R	92_T	0.541	0.21
18_I	59_R	0.540	0.21
4_G	93_A	0.539	0.21
30_A	80_V	0.539	0.21
77_V	121_P	0.537	0.21
34_A	60_D	0.537	0.21
95_L	98_D	0.536	0.21
78_D	91_A	0.533	0.20
10_V	18_I	0.524	0.20
4_G	8_L	0.522	0.20
14_D	27_S	0.518	0.20
18_I	119_F	0.516	0.20
29_D	112_T	0.513	0.20
20_F	93_A	0.512	0.20
29_D	79_A	0.509	0.19
3_P	7_T	0.509	0.19
13_D	91_A	0.508	0.19
63_H	95_L	0.508	0.19
15_A	29_D	0.506	0.19
61_A	66_I	0.504	0.19
67_D	89_E	0.500	0.19
67_D	107_G	0.500	0.19
67_D	110_D	0.500	0.19
89_E	107_G	0.500	0.19
89_E	110_D	0.500	0.19
107_G	110_D	0.500	0.19
37_G	110_D	0.500	0.19
35_Y	107_G	0.500	0.19
35_Y	110_D	0.500	0.19
47_R	110_D	0.500	0.19
47_R	107_G	0.500	0.19
47_R	89_E	0.500	0.19
47_R	67_D	0.500	0.19
47_R	65_H	0.500	0.19
37_G	47_R	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1yd0A	1	0.529	67.4	0.923	Contact Map
1mk0A	1	0.6232	58.1	0.927	Contact Map
1yd6A	5	0.6594	50.8	0.93	Contact Map
3mx1A	2	0.913	18.8	0.944	Contact Map
3clwA	1	0.3623	16.5	0.946	Contact Map
3zzpA	1	0.5362	9.3	0.952	Contact Map
2ovsA	2	0.7319	8.9	0.952	Contact Map
3og6A	1	0.3043	7.8	0.953	Contact Map
2idcA	1	0.5797	7.8	0.953	Contact Map
2fzpA	1	0.3986	7.3	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.