Q9HRG9 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRG9 - Uncharacterized protein

UniProt:	Q9HRG9	Sequences: MTDTDRLPAWCPGDSWCSITTTASLVGKKWHPVIIHRLLSEGPLGFNALQEEVDGISSKVLSESLDDLEDKQIVSRTIVSEKPVRVEYALTELGQSLEPVVSSMAEWGHQHLDPVDEEAASVV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	123 (101)
Sequences:	9751 (5811)
Seq/√Len:	578.2

ECOLI - YTFH
BACSU - YDEP YYBR YTCD YODB HXLR YKVN YDZF YVAP
HALSA - Q9HRG9 Q9HPZ4
SULSO - Q97UU6 Q97U48

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_S	89_A	2.778	1.00
96_S	110_Q	2.763	1.00
50_Q	58_S	2.756	1.00
59_K	63_E	2.754	1.00
81_E	85_R	2.539	1.00
39_L	98_E	2.516	1.00
77_T	89_A	2.442	1.00
38_L	74_V	2.280	1.00
75_S	91_T	2.278	1.00
37_R	52_E	2.079	1.00
79_V	87_E	1.986	1.00
38_L	49_L	1.800	1.00
93_L	111_H	1.781	1.00
79_V	85_R	1.695	1.00
103_S	106_E	1.694	1.00
100_V	103_S	1.674	1.00
43_P	89_A	1.634	1.00
90_L	94_G	1.616	1.00
99_P	103_S	1.613	1.00
34_I	64_S	1.589	1.00
44_L	52_E	1.588	1.00
66_D	69_E	1.583	1.00
60_V	63_E	1.543	1.00
43_P	87_E	1.498	1.00
31_H	67_D	1.436	1.00
95_Q	98_E	1.428	1.00
96_S	107_W	1.398	1.00
76_R	86_V	1.359	1.00
92_E	95_Q	1.358	1.00
31_H	64_S	1.355	1.00
22_T	104_M	1.344	1.00
73_I	94_G	1.330	1.00
93_L	96_S	1.258	1.00
58_S	62_S	1.244	1.00
25_L	71_K	1.240	1.00
22_T	108_G	1.238	1.00
28_K	67_D	1.223	1.00
38_L	44_L	1.177	1.00
78_I	83_P	1.168	1.00
79_V	83_P	1.168	1.00
44_L	48_A	1.143	1.00
47_N	51_E	1.119	1.00
28_K	64_S	1.112	1.00
105_A	109_H	1.104	1.00
69_E	74_V	1.098	1.00
93_L	114_P	1.078	1.00
35_I	90_L	1.074	1.00
73_I	97_L	1.067	1.00
77_T	87_E	1.066	1.00
46_F	62_S	1.054	1.00
21_T	112_L	1.050	1.00
79_V	84_V	1.035	1.00
28_K	31_H	1.026	1.00
45_G	87_E	1.023	1.00
96_S	111_H	0.987	1.00
79_V	82_K	0.986	1.00
31_H	68_L	0.979	1.00
62_S	66_D	0.975	1.00
80_S	83_P	0.974	1.00
89_A	95_Q	0.972	1.00
32_P	101_V	0.961	1.00
98_E	102_S	0.947	1.00
78_I	84_V	0.943	1.00
60_V	64_S	0.941	1.00
78_I	86_V	0.933	1.00
25_L	73_I	0.923	1.00
34_I	53_V	0.913	1.00
39_L	90_L	0.902	1.00
56_I	61_L	0.881	1.00
57_S	60_V	0.880	1.00
31_H	71_K	0.874	1.00
106_E	110_Q	0.873	1.00
99_P	106_E	0.873	1.00
97_L	107_W	0.870	1.00
48_A	51_E	0.862	1.00
46_F	58_S	0.851	1.00
102_S	106_E	0.844	1.00
37_R	49_L	0.833	1.00
72_Q	93_L	0.828	1.00
20_T	24_S	0.816	1.00
47_N	50_Q	0.808	1.00
34_I	56_I	0.791	1.00
18_S	109_H	0.780	1.00
30_W	56_I	0.760	1.00
39_L	102_S	0.756	1.00
78_I	82_K	0.756	1.00
53_V	56_I	0.750	1.00
36_H	105_A	0.748	1.00
67_D	71_K	0.745	1.00
21_T	111_H	0.738	1.00
100_V	104_M	0.734	1.00
111_H	114_P	0.722	1.00
44_L	49_L	0.721	1.00
78_I	81_E	0.692	1.00
15_S	20_T	0.682	1.00
56_I	86_V	0.682	1.00
82_K	86_V	0.673	1.00
63_E	67_D	0.662	1.00
97_L	100_V	0.660	1.00
23_A	97_L	0.657	1.00
23_A	32_P	0.657	1.00
45_G	79_V	0.656	1.00
23_A	104_M	0.651	1.00
38_L	43_P	0.638	1.00
42_G	95_Q	0.635	1.00
106_E	109_H	0.632	1.00
69_E	78_I	0.630	1.00
36_H	39_L	0.630	1.00
33_V	37_R	0.621	1.00
102_S	105_A	0.619	1.00
40_S	44_L	0.617	1.00
15_S	24_S	0.614	1.00
58_S	64_S	0.608	1.00
108_G	112_L	0.605	1.00
68_L	73_I	0.598	1.00
40_S	52_E	0.596	1.00
48_A	52_E	0.594	1.00
38_L	69_E	0.586	1.00
13_G	19_I	0.581	1.00
81_E	84_V	0.581	1.00
37_R	44_L	0.577	1.00
69_E	76_R	0.577	1.00
33_V	53_V	0.575	1.00
19_I	112_L	0.570	1.00
46_F	50_Q	0.570	1.00
110_Q	113_D	0.566	0.99
81_E	86_V	0.566	0.99
81_E	87_E	0.565	0.99
35_I	97_L	0.565	0.99
45_G	48_A	0.564	0.99
107_W	111_H	0.554	0.99
83_P	86_V	0.552	0.99
109_H	112_L	0.551	0.99
20_T	32_P	0.551	0.99
47_N	58_S	0.546	0.99
15_S	21_T	0.542	0.99
50_Q	61_L	0.535	0.99
21_T	24_S	0.533	0.99
43_P	48_A	0.533	0.99
17_C	46_F	0.530	0.99
93_L	112_L	0.528	0.99
100_V	108_G	0.526	0.99
99_P	102_S	0.524	0.99
43_P	49_L	0.521	0.99
82_K	85_R	0.513	0.99
96_S	99_P	0.508	0.99
35_I	73_I	0.506	0.99
20_T	54_D	0.505	0.99
26_V	104_M	0.504	0.99
90_L	95_Q	0.503	0.99
36_H	46_F	0.503	0.99
92_E	96_S	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gcvA	3	0.8455	99.9	0.417	Contact Map
4a5nA	2	0.8537	99.7	0.488	Contact Map
1yyvA	2	0.9106	99.7	0.503	Contact Map
2hztA	2	0.7724	99.7	0.52	Contact Map
1z7uA	2	0.9024	99.7	0.521	Contact Map
2fswA	2	0.8374	99.7	0.523	Contact Map
2f2eA	4	0.9024	99.6	0.532	Contact Map
4hw0A	2	0.7642	99.6	0.56	Contact Map
3df8A	2	0.8537	99.5	0.574	Contact Map
4hqeA	2	0.8699	99.4	0.594	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.