Q9HRE7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRE7 - Uncharacterized protein

UniProt:	Q9HRE7	Sequences: MSPIPLPVTDTDDAWRARIAAHRADKDEFLATHDQSPIPPADRGAFDGLRYFDIDASFRVAARYQPARDPEAVELETTRGPPAEYTRAAVLGFDLGDSHHTLTAFRVEGESSLFVPFTDETTDDGRTYEHGRYLDVDPAGADGGDEVALDFNLAYNPFCAYGGSFSCALPPADNHVPAAITAGERVDAD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (158)
Sequences:	876 (620)
Seq/√Len:	49.3

HALSA - Q9HRE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
65_Q	92_G	3.969	1.00
126_R	181_T	3.738	1.00
95_L	178_A	3.351	1.00
118_T	175_H	3.284	1.00
61_A	146_E	2.968	1.00
104_A	115_V	2.729	1.00
59_R	148_A	2.714	1.00
52_F	126_R	2.691	1.00
90_V	101_T	2.689	1.00
62_A	91_L	2.427	1.00
94_D	99_H	2.395	1.00
117_F	154_A	2.385	1.00
49_L	161_Y	2.313	1.00
128_Y	159_C	2.310	1.00
74_E	82_P	2.287	1.00
91_L	115_V	2.225	1.00
91_L	147_V	2.165	1.00
100_H	178_A	2.120	1.00
133_Y	157_P	2.060	1.00
65_Q	90_V	2.035	1.00
118_T	122_T	2.020	1.00
52_F	127_T	2.000	1.00
92_G	101_T	1.967	0.99
103_T	173_D	1.933	0.99
91_L	104_A	1.914	0.99
67_A	90_V	1.788	0.99
134_L	149_L	1.738	0.99
140_G	146_E	1.732	0.99
60_V	95_L	1.699	0.98
140_G	144_G	1.657	0.98
92_G	99_H	1.647	0.98
39_P	42_D	1.639	0.98
90_V	103_T	1.521	0.97
64_Y	89_A	1.513	0.97
77_T	83_A	1.509	0.97
62_A	147_V	1.491	0.96
93_F	151_F	1.479	0.96
135_D	155_Y	1.444	0.96
23_R	27_D	1.419	0.95
104_A	113_L	1.386	0.94
31_A	161_Y	1.386	0.94
116_P	133_Y	1.371	0.94
159_C	171_P	1.357	0.94
60_V	93_F	1.348	0.94
94_D	97_D	1.316	0.93
112_S	137_D	1.295	0.92
67_A	103_T	1.286	0.92
55_D	181_T	1.258	0.91
134_L	151_F	1.250	0.91
74_E	84_E	1.215	0.89
98_S	177_P	1.213	0.89
57_S	95_L	1.200	0.89
61_A	148_A	1.195	0.89
117_F	151_F	1.169	0.87
130_H	165_F	1.159	0.87
121_T	171_P	1.149	0.87
23_R	51_Y	1.131	0.86
64_Y	104_A	1.130	0.86
87_R	103_T	1.126	0.85
23_R	26_K	1.124	0.85
126_R	179_A	1.124	0.85
140_G	145_D	1.108	0.84
113_L	139_A	1.102	0.84
70_P	86_T	1.094	0.84
50_R	186_V	1.078	0.83
128_Y	131_G	1.070	0.82
78_T	166_S	1.068	0.82
33_H	158_F	1.065	0.82
132_R	154_A	1.063	0.82
156_N	160_A	1.048	0.81
116_P	157_P	1.034	0.80
129_E	163_G	1.031	0.80
77_T	81_P	1.020	0.79
121_T	151_F	1.016	0.79
81_P	166_S	1.014	0.79
26_K	184_E	1.007	0.78
105_F	116_P	1.005	0.78
122_T	186_V	0.997	0.78
35_Q	166_S	0.987	0.77
52_F	130_H	0.982	0.77
114_F	155_Y	0.979	0.76
36_S	49_L	0.976	0.76
106_R	109_G	0.970	0.76
88_A	113_L	0.969	0.76
64_Y	93_F	0.964	0.75
23_R	184_E	0.956	0.75
39_P	44_G	0.955	0.75
77_T	160_A	0.952	0.74
58_F	180_I	0.951	0.74
46_F	49_L	0.950	0.74
57_S	96_G	0.944	0.74
123_D	186_V	0.939	0.73
128_Y	171_P	0.920	0.72
131_G	155_Y	0.918	0.72
151_F	180_I	0.912	0.71
26_K	29_F	0.909	0.71
132_R	170_P	0.903	0.70
109_G	112_S	0.900	0.70
93_F	149_L	0.886	0.69
78_T	162_G	0.879	0.68
100_H	180_I	0.877	0.68
102_L	172_A	0.874	0.68
58_F	181_T	0.868	0.67
120_E	177_P	0.858	0.66
95_L	180_I	0.856	0.66
63_R	92_G	0.854	0.66
120_E	179_A	0.846	0.65
159_C	169_L	0.846	0.65
170_P	175_H	0.845	0.65
154_A	180_I	0.836	0.64
117_F	180_I	0.833	0.64
150_D	154_A	0.828	0.64
83_A	166_S	0.818	0.63
63_R	146_E	0.817	0.62
89_A	113_L	0.810	0.62
131_G	159_C	0.801	0.61
40_P	163_G	0.780	0.59
52_F	121_T	0.780	0.59
53_D	56_A	0.769	0.58
93_F	139_A	0.767	0.58
26_K	51_Y	0.766	0.58
128_Y	157_P	0.761	0.57
50_R	185_R	0.755	0.56
100_H	177_P	0.746	0.56
129_E	170_P	0.740	0.55
112_S	136_V	0.736	0.54
111_S	137_D	0.735	0.54
29_F	166_S	0.732	0.54
146_E	149_L	0.725	0.53
114_F	157_P	0.722	0.53
72_A	86_T	0.721	0.53
118_T	159_C	0.717	0.53
131_G	170_P	0.713	0.52
161_Y	184_E	0.710	0.52
42_D	45_A	0.698	0.51
120_E	127_T	0.695	0.50
58_F	95_L	0.695	0.50
156_N	165_F	0.687	0.50
44_G	47_D	0.686	0.49
54_I	153_L	0.686	0.49
25_D	28_E	0.684	0.49
42_D	162_G	0.683	0.49
30_L	49_L	0.676	0.48
136_V	149_L	0.666	0.47
106_R	138_P	0.663	0.47
136_V	147_V	0.651	0.46
120_E	178_A	0.650	0.46
79_R	166_S	0.647	0.45
33_H	36_S	0.646	0.45
80_G	83_A	0.642	0.45
36_S	78_T	0.639	0.45
60_V	149_L	0.637	0.44
133_Y	155_Y	0.637	0.44
67_A	87_R	0.633	0.44
105_F	175_H	0.629	0.44
61_A	149_L	0.627	0.43
35_Q	165_F	0.622	0.43
89_A	104_A	0.618	0.43
63_R	112_S	0.617	0.42
33_H	164_S	0.616	0.42
26_K	33_H	0.615	0.42
95_L	176_V	0.614	0.42
47_D	66_P	0.609	0.42
156_N	166_S	0.608	0.42
60_V	147_V	0.608	0.42
33_H	184_E	0.605	0.41
40_P	162_G	0.598	0.41
91_L	98_S	0.597	0.40
91_L	136_V	0.596	0.40
56_A	96_G	0.595	0.40
23_R	32_T	0.594	0.40
60_V	177_P	0.591	0.40
96_G	180_I	0.590	0.40
24_A	40_P	0.589	0.40
27_D	48_G	0.588	0.40
99_H	125_G	0.587	0.39
30_L	46_F	0.586	0.39
95_L	100_H	0.585	0.39
83_A	157_P	0.585	0.39
25_D	29_F	0.583	0.39
101_T	134_L	0.582	0.39
107_V	135_D	0.582	0.39
97_D	100_H	0.580	0.39
62_A	149_L	0.579	0.39
57_S	61_A	0.574	0.38
94_D	100_H	0.572	0.38
66_P	89_A	0.571	0.38
150_D	184_E	0.568	0.38
64_Y	122_T	0.568	0.38
39_P	48_G	0.562	0.37
34_D	161_Y	0.562	0.37
77_T	116_P	0.561	0.37
68_R	76_E	0.559	0.37
44_G	58_F	0.554	0.36
49_L	77_T	0.553	0.36
30_L	36_S	0.551	0.36
34_D	39_P	0.550	0.36
114_F	133_Y	0.548	0.36
44_G	179_A	0.548	0.36
38_I	51_Y	0.546	0.36
65_Q	101_T	0.543	0.35
106_R	112_S	0.543	0.35
121_T	126_R	0.539	0.35
31_A	76_E	0.539	0.35
56_A	154_A	0.538	0.35
102_L	177_P	0.535	0.35
118_T	169_L	0.535	0.35
59_R	153_L	0.535	0.35
44_G	177_P	0.533	0.34
117_F	122_T	0.531	0.34
55_D	96_G	0.527	0.34
137_D	148_A	0.525	0.34
71_E	102_L	0.525	0.34
60_V	113_L	0.525	0.34
107_V	112_S	0.524	0.34
75_L	114_F	0.524	0.34
162_G	165_F	0.523	0.33
107_V	110_E	0.522	0.33
133_Y	159_C	0.521	0.33
60_V	151_F	0.519	0.33
158_F	164_S	0.518	0.33
47_D	99_H	0.517	0.33
112_S	135_D	0.517	0.33
138_P	145_D	0.516	0.33
130_H	159_C	0.514	0.33
131_G	157_P	0.514	0.33
31_A	70_P	0.511	0.32
58_F	151_F	0.510	0.32
51_Y	54_I	0.509	0.32
144_G	148_A	0.507	0.32
39_P	163_G	0.504	0.32
50_R	157_P	0.504	0.32
63_R	153_L	0.504	0.32
104_A	136_V	0.504	0.32
39_P	49_L	0.503	0.32
167_C	183_G	0.502	0.32
89_A	185_R	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lokA	1	0.9947	100	0.076	Contact Map
2lnuA	1	0.9577	100	0.115	Contact Map
3wajA	1	0.7196	16.8	0.956	Contact Map
3h7hA	1	0.3175	6	0.964	Contact Map
3kd4A	3	0.7037	5.4	0.965	Contact Map
4n0rA	2	0.4974	3.9	0.967	Contact Map
3nvxA	1	0.5079	2.7	0.969	Contact Map
4av2A	3	0	2.5	0.97	Contact Map
4w60A	1	0.4497	2.4	0.97	Contact Map
3c0fB	2	0.3968	2.3	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.