Q9HRD8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRD8 - Uncharacterized protein

UniProt:	Q9HRD8	Sequences: MRCSYPATAPCFMVAAQAVSGMDRAIAVVEASDSAKQLVEEAGELAAGVGADLLLLHVTTETEYGERRESMANIPDFDVTYTIDEATDGARKFASDIGRDVLSDVDIEPTSVGRVGDKGDEILALADDRDADHIFIAGRKRSPTGKAIFGDVTQRIILEFDGAVTVITT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	169 (136)
Sequences:	19421 (15379)
Seq/√Len:	1318.7

ECOLI - USPE USPF USPG USPC USPA USPD
BACSU - NHAX YXIE
HALSA - Q9HRD8 Q9HNX9 Q9HPP5 Q9HRP5 Q9HMJ0 Q9HHX5 Q9HPQ8 Q9HPF7 Q9HMI9 Q9HHV8 Q9HP90 Q9HHY0 Q9HMU1
SULSO - Q97V57 Q97X90 Q7LXW4 Q97U40

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_L	112_V	3.000	1.00
24_R	54_L	2.842	1.00
26_I	131_A	2.593	1.00
119_G	155_R	2.582	1.00
52_D	110_T	2.523	1.00
24_R	52_D	2.516	1.00
41_E	165_T	2.337	1.00
133_H	165_T	2.307	1.00
112_V	125_L	2.252	1.00
125_L	129_R	2.076	1.00
116_G	121_E	2.012	1.00
136_I	156_I	1.989	1.00
154_Q	158_L	1.915	1.00
126_A	134_I	1.867	1.00
54_L	110_T	1.847	1.00
134_I	162_G	1.828	1.00
54_L	129_R	1.822	1.00
114_R	121_E	1.744	1.00
54_L	131_A	1.741	1.00
28_V	136_I	1.741	1.00
58_V	121_E	1.708	1.00
54_L	125_L	1.673	1.00
56_L	125_L	1.646	1.00
40_E	101_V	1.641	1.00
27_A	42_A	1.603	1.00
24_R	132_D	1.585	1.00
28_V	122_I	1.568	1.00
121_E	124_A	1.537	1.00
87_T	91_R	1.537	1.00
127_D	161_D	1.483	1.00
45_L	49_V	1.443	1.00
155_R	159_E	1.401	1.00
51_A	132_D	1.388	1.00
52_D	108_E	1.382	1.00
134_I	160_F	1.381	1.00
91_R	95_S	1.365	1.00
57_H	90_A	1.363	1.00
123_L	159_E	1.361	1.00
114_R	125_L	1.285	1.00
27_A	39_V	1.281	1.00
126_A	161_D	1.263	1.00
112_V	129_R	1.261	1.00
42_A	46_A	1.259	1.00
36_K	101_V	1.252	1.00
134_I	156_I	1.235	1.00
160_F	164_V	1.201	1.00
90_A	93_F	1.200	1.00
22_M	163_A	1.163	1.00
125_L	128_D	1.146	1.00
56_L	114_R	1.138	1.00
93_F	97_I	1.137	1.00
101_V	104_D	1.125	1.00
118_K	152_V	1.079	1.00
29_V	97_I	1.060	1.00
47_A	105_V	1.049	1.00
138_G	168_T	1.048	1.00
138_G	166_V	1.048	1.00
56_L	122_I	1.042	1.00
95_S	111_S	1.033	1.00
157_I	166_V	1.030	1.00
144_T	148_I	1.020	1.00
24_R	131_A	1.018	1.00
126_A	162_G	1.017	1.00
22_M	41_E	1.012	1.00
41_E	167_I	1.010	1.00
25_A	133_H	1.008	1.00
146_K	154_Q	1.007	1.00
39_V	55_L	0.998	1.00
58_V	118_K	0.998	1.00
88_D	92_K	0.996	1.00
83_I	87_T	0.994	1.00
39_V	97_I	0.990	1.00
35_A	38_L	0.977	1.00
114_R	128_D	0.974	1.00
124_A	128_D	0.967	1.00
59_T	115_V	0.965	1.00
126_A	131_A	0.962	1.00
55_L	109_P	0.945	1.00
93_F	96_D	0.944	1.00
86_A	89_G	0.936	1.00
44_E	48_G	0.933	1.00
84_D	88_D	0.932	1.00
136_I	153_T	0.932	1.00
97_I	101_V	0.922	1.00
41_E	45_L	0.917	1.00
24_R	129_R	0.910	1.00
41_E	44_E	0.903	1.00
31_A	57_H	0.902	1.00
42_A	135_F	0.888	1.00
29_V	55_L	0.882	1.00
49_V	132_D	0.879	1.00
153_T	166_V	0.872	1.00
26_I	56_L	0.859	1.00
42_A	53_L	0.858	1.00
89_G	93_F	0.855	1.00
59_T	113_G	0.852	1.00
43_G	105_V	0.852	1.00
46_A	53_L	0.844	1.00
90_A	94_A	0.843	1.00
43_G	107_I	0.842	1.00
123_L	126_A	0.838	1.00
143_P	146_K	0.837	1.00
32_S	35_A	0.833	1.00
29_V	38_L	0.831	1.00
100_D	103_S	0.821	1.00
89_G	92_K	0.820	1.00
94_A	111_S	0.820	1.00
26_I	134_I	0.818	1.00
141_R	145_G	0.815	1.00
29_V	39_V	0.804	1.00
86_A	90_A	0.804	1.00
43_G	102_L	0.803	1.00
123_L	156_I	0.802	1.00
90_A	113_G	0.798	1.00
26_I	125_L	0.793	1.00
110_T	129_R	0.793	1.00
41_E	163_A	0.793	1.00
100_D	104_D	0.792	1.00
102_L	109_P	0.787	1.00
92_K	96_D	0.780	1.00
39_V	43_G	0.779	1.00
37_Q	40_E	0.778	1.00
31_A	93_F	0.776	1.00
123_L	160_F	0.774	1.00
85_E	89_G	0.770	1.00
22_M	132_D	0.767	1.00
125_L	131_A	0.767	1.00
36_K	40_E	0.764	1.00
27_A	53_L	0.762	1.00
135_F	165_T	0.757	1.00
46_A	49_V	0.757	1.00
44_E	47_A	0.754	1.00
36_K	96_D	0.750	1.00
88_D	91_R	0.749	1.00
31_A	97_I	0.746	1.00
32_S	140_K	0.742	1.00
117_D	120_D	0.739	1.00
47_A	106_D	0.735	1.00
28_V	137_A	0.723	1.00
23_D	51_A	0.722	1.00
85_E	88_D	0.721	1.00
122_I	156_I	0.718	1.00
27_A	38_L	0.711	1.00
57_H	93_F	0.705	1.00
144_T	147_A	0.703	1.00
22_M	133_H	0.695	1.00
23_D	132_D	0.695	1.00
46_A	51_A	0.692	1.00
138_G	153_T	0.691	1.00
143_P	147_A	0.689	1.00
55_L	97_I	0.675	1.00
29_V	36_K	0.673	1.00
24_R	51_A	0.670	1.00
97_I	102_L	0.668	1.00
95_S	100_D	0.664	1.00
42_A	51_A	0.664	1.00
136_I	166_V	0.664	1.00
140_K	149_F	0.664	1.00
91_R	111_S	0.664	1.00
45_L	48_G	0.663	1.00
119_G	123_L	0.658	1.00
119_G	156_I	0.656	1.00
36_K	97_I	0.655	1.00
87_T	115_V	0.655	1.00
96_D	100_D	0.644	1.00
25_A	46_A	0.640	1.00
121_E	125_L	0.638	1.00
94_A	113_G	0.637	1.00
22_M	51_A	0.635	1.00
29_V	35_A	0.631	1.00
59_T	90_A	0.631	1.00
43_G	47_A	0.629	1.00
130_D	162_G	0.626	1.00
38_L	135_F	0.623	1.00
65_G	69_E	0.617	1.00
55_L	102_L	0.615	1.00
56_L	121_E	0.613	1.00
84_D	87_T	0.603	1.00
119_G	152_V	0.599	1.00
34_S	37_Q	0.598	1.00
120_D	124_A	0.587	1.00
96_D	101_V	0.583	1.00
45_L	135_F	0.579	1.00
25_A	135_F	0.577	1.00
55_L	111_S	0.576	1.00
59_T	87_T	0.576	1.00
33_D	36_K	0.568	1.00
138_G	148_I	0.566	1.00
149_F	153_T	0.563	1.00
137_A	167_I	0.557	1.00
156_I	164_V	0.552	1.00
127_D	162_G	0.551	1.00
112_V	115_V	0.543	1.00
119_G	159_E	0.542	1.00
22_M	165_T	0.535	1.00
92_K	95_S	0.532	1.00
116_G	124_A	0.526	1.00
30_E	35_A	0.518	1.00
43_G	53_L	0.515	1.00
61_E	115_V	0.507	1.00
123_L	155_R	0.506	1.00
140_K	150_G	0.506	1.00
58_V	116_G	0.501	1.00
83_I	115_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mt0A	1	0.8698	99.9	0.239	Contact Map
4r2kA	2	0.9527	99.9	0.24	Contact Map
4wy2A	2	0.9408	99.9	0.253	Contact Map
2gm3A	2	0.7515	99.9	0.254	Contact Map
3s3tA	4	0.8462	99.9	0.261	Contact Map
5ahwA	4	0.8521	99.9	0.262	Contact Map
3cisA	4	0.9172	99.9	0.262	Contact Map
4wnyA	2	0.7692	99.9	0.263	Contact Map
3hgmA	2	0.8521	99.9	0.27	Contact Map
1mjhA	2	0.8343	99.9	0.271	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.