TFE - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TFE - Transcription factor E

UniProt:	Q9HRC7	Sequences: MAFEDLLDDPVVQKYLHELVGPKGMPVAAAPPDGEVTDEELAERLGLELNDVRRALFILYENDLATYRRVRDEDSGWLTYLWTFQYENVPGNLREEMDRLLEALVDRREYELENEFYLCEVCSIRFEFGEAMDLGFECPECGSAVEAMENTDLVDAMDDRIERLRSELAVEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (160)
Sequences:	164 (118)
Seq/√Len:	9.3

HALSA - TFE
SULSO - TFE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_L	158_D	4.223	0.99
105_V	165_R	4.199	0.99
94_R	168_L	3.813	0.98
23_K	45_L	3.080	0.92
101_L	161_I	2.984	0.91
110_Y	116_F	2.900	0.90
60_Y	65_A	2.841	0.89
35_E	68_R	2.726	0.86
110_Y	114_N	2.503	0.81
37_T	72_D	2.493	0.81
87_E	164_L	2.469	0.80
126_F	130_E	2.353	0.77
105_V	135_G	2.161	0.70
27_V	47_L	2.138	0.69
57_F	78_L	2.077	0.67
15_Y	160_R	2.075	0.67
104_L	107_R	2.017	0.65
104_L	161_I	1.840	0.57
107_R	116_F	1.821	0.56
150_N	154_V	1.791	0.55
9_D	89_V	1.720	0.52
9_D	44_R	1.718	0.52
102_E	106_D	1.696	0.51
64_L	117_Y	1.646	0.49
46_G	93_L	1.622	0.48
41_L	168_L	1.600	0.47
46_G	139_P	1.568	0.45
18_E	27_V	1.550	0.44
84_F	140_E	1.539	0.44
41_L	154_V	1.480	0.41
21_G	117_Y	1.460	0.41
39_E	52_V	1.455	0.40
108_R	129_G	1.427	0.39
52_V	65_A	1.413	0.39
21_G	76_G	1.395	0.38
58_I	112_L	1.372	0.37
101_L	159_D	1.371	0.37
45_L	73_E	1.368	0.37
113_E	120_E	1.356	0.36
61_E	71_R	1.353	0.36
99_R	127_E	1.347	0.36
52_V	136_F	1.339	0.36
12_V	16_L	1.329	0.35
19_L	93_L	1.313	0.35
67_Y	74_D	1.302	0.34
134_L	145_V	1.290	0.34
151_T	158_D	1.257	0.32
16_L	20_V	1.241	0.32
38_D	133_D	1.226	0.31
19_L	58_I	1.214	0.31
72_D	77_W	1.212	0.31
107_R	110_Y	1.205	0.30
15_Y	81_L	1.200	0.30
45_L	137_E	1.192	0.30
135_G	153_L	1.179	0.29
75_S	100_L	1.178	0.29
69_R	150_N	1.176	0.29
35_E	61_E	1.153	0.28
63_D	67_Y	1.152	0.28
22_P	164_L	1.147	0.28
57_F	80_Y	1.138	0.28
37_T	54_R	1.103	0.27
42_A	80_Y	1.101	0.27
80_Y	141_C	1.080	0.26
22_P	163_R	1.078	0.26
35_E	42_A	1.076	0.26
38_D	101_L	1.065	0.25
38_D	43_E	1.055	0.25
108_R	154_V	1.055	0.25
45_L	118_L	1.050	0.25
120_E	124_I	1.040	0.25
108_R	111_E	1.039	0.25
108_R	139_P	1.035	0.24
64_L	80_Y	1.030	0.24
20_V	25_M	1.030	0.24
104_L	111_E	1.030	0.24
57_F	77_W	1.011	0.24
75_S	127_E	1.010	0.24
64_L	133_D	1.008	0.24
92_N	109_E	1.003	0.23
10_P	34_G	0.997	0.23
69_R	72_D	0.985	0.23
135_G	163_R	0.980	0.23
162_E	166_S	0.975	0.22
87_E	126_F	0.973	0.22
69_R	80_Y	0.951	0.22
71_R	76_G	0.949	0.22
111_E	150_N	0.946	0.22
65_A	69_R	0.935	0.21
98_D	134_L	0.935	0.21
72_D	76_G	0.931	0.21
106_D	143_S	0.925	0.21
112_L	123_S	0.918	0.21
49_L	81_L	0.912	0.21
158_D	162_E	0.911	0.21
81_L	96_E	0.896	0.20
50_N	77_W	0.892	0.20
90_P	150_N	0.888	0.20
69_R	77_W	0.888	0.20
16_L	81_L	0.885	0.20
35_E	93_L	0.881	0.20
38_D	58_I	0.881	0.20
9_D	157_M	0.879	0.20
39_E	151_T	0.878	0.20
69_R	111_E	0.871	0.19
46_G	157_M	0.871	0.19
125_R	148_M	0.868	0.19
53_R	138_C	0.866	0.19
35_E	64_L	0.859	0.19
120_E	126_F	0.858	0.19
16_L	28_A	0.856	0.19
78_L	96_E	0.852	0.19
28_A	129_G	0.847	0.19
37_T	133_D	0.846	0.19
62_N	75_S	0.838	0.19
52_V	60_Y	0.838	0.19
71_R	115_E	0.836	0.18
30_A	85_Q	0.832	0.18
15_Y	32_P	0.829	0.18
49_L	77_W	0.822	0.18
54_R	78_L	0.815	0.18
9_D	28_A	0.812	0.18
34_G	149_E	0.811	0.18
33_D	142_G	0.807	0.18
155_D	162_E	0.805	0.18
53_R	119_C	0.802	0.18
119_C	138_C	0.802	0.18
89_V	130_E	0.798	0.17
9_D	12_V	0.789	0.17
66_T	78_L	0.787	0.17
19_L	143_S	0.782	0.17
63_D	160_R	0.780	0.17
67_Y	88_N	0.773	0.17
93_L	96_E	0.763	0.17
103_A	117_Y	0.755	0.16
88_N	117_Y	0.755	0.16
27_V	36_V	0.754	0.16
64_L	69_R	0.740	0.16
26_P	91_G	0.738	0.16
29_A	129_G	0.737	0.16
145_V	151_T	0.731	0.16
106_D	154_V	0.730	0.16
13_Q	87_E	0.726	0.16
109_E	113_E	0.723	0.16
52_V	69_R	0.717	0.16
143_S	155_D	0.715	0.15
44_R	159_D	0.714	0.15
16_L	161_I	0.711	0.15
40_E	52_V	0.710	0.15
78_L	81_L	0.707	0.15
140_E	158_D	0.704	0.15
98_D	107_R	0.703	0.15
38_D	168_L	0.702	0.15
88_N	107_R	0.701	0.15
108_R	153_L	0.698	0.15
77_W	80_Y	0.696	0.15
15_Y	78_L	0.695	0.15
23_K	107_R	0.694	0.15
61_E	96_E	0.687	0.15
54_R	66_T	0.681	0.15
128_F	136_F	0.679	0.15
18_E	36_V	0.672	0.15
126_F	132_M	0.669	0.14
15_Y	39_E	0.666	0.14
52_V	128_F	0.657	0.14
56_L	138_C	0.649	0.14
53_R	56_L	0.649	0.14
129_G	166_S	0.645	0.14
21_G	107_R	0.644	0.14
17_H	22_P	0.643	0.14
42_A	68_R	0.641	0.14
14_K	62_N	0.641	0.14
151_T	154_V	0.641	0.14
30_A	114_N	0.638	0.14
37_T	52_V	0.630	0.14
109_E	133_D	0.624	0.13
26_P	94_R	0.624	0.13
104_L	108_R	0.624	0.13
14_K	107_R	0.620	0.13
110_Y	128_F	0.620	0.13
48_E	65_A	0.618	0.13
11_V	22_P	0.617	0.13
24_G	55_A	0.616	0.13
31_P	39_E	0.610	0.13
101_L	164_L	0.605	0.13
162_E	165_R	0.601	0.13
56_L	59_L	0.600	0.13
27_V	50_N	0.598	0.13
85_Q	168_L	0.596	0.13
119_C	141_C	0.594	0.13
111_E	128_F	0.591	0.13
41_L	141_C	0.587	0.13
117_Y	156_A	0.586	0.13
102_E	143_S	0.586	0.13
83_T	113_E	0.580	0.13
97_M	167_E	0.580	0.13
76_G	160_R	0.578	0.13
76_G	81_L	0.574	0.12
56_L	119_C	0.573	0.12
110_Y	125_R	0.571	0.12
76_G	115_E	0.569	0.12
49_L	116_F	0.563	0.12
23_K	105_V	0.563	0.12
142_G	152_D	0.563	0.12
110_Y	166_S	0.562	0.12
95_E	143_S	0.561	0.12
50_N	136_F	0.561	0.12
100_L	116_F	0.555	0.12
39_E	75_S	0.555	0.12
137_E	142_G	0.552	0.12
133_D	145_V	0.545	0.12
144_A	154_V	0.544	0.12
12_V	34_G	0.543	0.12
40_E	157_M	0.542	0.12
155_D	161_I	0.540	0.12
101_L	157_M	0.540	0.12
15_Y	116_F	0.540	0.12
49_L	79_T	0.539	0.12
27_V	135_G	0.538	0.12
156_A	162_E	0.538	0.12
61_E	156_A	0.538	0.12
134_L	144_A	0.537	0.12
91_G	133_D	0.532	0.12
133_D	136_F	0.529	0.12
61_E	70_V	0.528	0.12
108_R	113_E	0.527	0.12
152_D	155_D	0.526	0.12
41_L	135_G	0.524	0.12
147_A	167_E	0.523	0.12
125_R	152_D	0.523	0.12
16_L	95_E	0.521	0.11
22_P	99_R	0.521	0.11
75_S	132_M	0.520	0.11
43_E	74_D	0.520	0.11
117_Y	126_F	0.517	0.11
72_D	78_L	0.515	0.11
46_G	94_R	0.509	0.11
39_E	110_Y	0.505	0.11
52_V	75_S	0.505	0.11
132_M	166_S	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xubA	1	0.7965	99.9	0.65	Contact Map
1q1hA	1	0.4826	98.9	0.81	Contact Map
1vd4A	1	0.3256	98	0.856	Contact Map
4qiwP	1	0.2442	97.1	0.881	Contact Map
4aybP	1	0.25	96.5	0.889	Contact Map
3mwmA	2	0.5756	95.8	0.896	Contact Map
3pwfA	4	0.8081	95.6	0.897	Contact Map
2o03A	2	0.5872	95.6	0.898	Contact Map
1vziA	2	0.3488	95.4	0.899	Contact Map
2oqgA	4	0.5988	95.3	0.899	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.