Q9HRA7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRA7 - CDP-diacylglycerol-serine O-phosphatidyltransferase

UniProt:	Q9HRA7	Sequences: MQPRFVGRLGVADAVTTANAALGFLAVVTAPSNPRLAARIVLVAAIADGLDGVVARRLGSTPAGKHLDSLADVASFGVAPACIVVAATGNTWQAGAPVGIGALVVGAGFVASAVVRLGLYTAYDTGHEHTEGVQTTLAATLLAAGVLAGVEQPTVIVGAAGVLAVLMVSTIEYPDLLVRDALAMGVVQAGAVVAPAALAGAFPKALFGWAGAYLVFAPRFYWRAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	225 (207)
Sequences:	2182 (1423)
Seq/√Len:	98.9

BACSU - PSS
HALSA - Q9HRA7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
113_A	135_T	8.042	1.00
44_A	75_S	4.943	1.00
17_T	67_L	4.046	1.00
15_V	54_V	3.958	1.00
26_A	79_A	3.580	1.00
113_A	167_M	3.395	1.00
73_V	114_V	2.902	1.00
62_P	66_H	2.881	1.00
74_A	78_V	2.733	1.00
19_N	75_S	2.563	1.00
20_A	71_A	2.300	1.00
162_V	166_L	2.294	1.00
30_A	83_I	2.156	1.00
19_N	47_A	2.153	1.00
65_K	124_D	2.147	1.00
22_L	47_A	2.118	1.00
108_G	164_A	2.112	1.00
31_P	82_C	2.037	1.00
77_G	113_A	2.014	1.00
109_F	138_A	2.011	1.00
33_N	36_L	1.980	1.00
21_A	107_A	1.977	1.00
22_L	40_I	1.937	1.00
26_A	83_I	1.921	1.00
17_T	111_A	1.904	1.00
81_A	110_V	1.902	1.00
66_H	122_A	1.854	1.00
19_N	44_A	1.815	1.00
180_D	185_G	1.802	1.00
138_A	167_M	1.781	1.00
84_V	160_A	1.779	1.00
31_P	86_A	1.750	1.00
46_I	50_L	1.745	1.00
27_V	79_A	1.717	1.00
105_V	161_G	1.712	1.00
45_A	140_T	1.698	1.00
173_Y	217_A	1.693	1.00
112_S	168_V	1.680	1.00
20_A	74_A	1.675	1.00
205_A	209_W	1.634	1.00
201_A	204_K	1.632	1.00
138_A	163_L	1.553	1.00
24_F	107_A	1.537	1.00
69_S	121_T	1.536	1.00
89_G	102_A	1.491	1.00
70_L	118_G	1.485	1.00
148_A	207_F	1.477	1.00
26_A	30_A	1.458	1.00
20_A	114_V	1.454	1.00
88_T	102_A	1.442	1.00
41_V	143_A	1.431	1.00
14_A	18_A	1.411	1.00
174_P	216_F	1.383	0.99
18_A	47_A	1.378	0.99
62_P	65_K	1.368	0.99
66_H	121_T	1.348	0.99
142_L	160_A	1.316	0.99
92_W	157_V	1.296	0.99
119_L	169_S	1.287	0.99
24_F	110_V	1.285	0.99
125_T	131_E	1.279	0.99
27_V	78_V	1.275	0.99
144_A	207_F	1.273	0.99
161_G	165_V	1.267	0.99
25_L	29_T	1.247	0.99
88_T	91_T	1.239	0.99
131_E	170_T	1.220	0.99
182_L	185_G	1.209	0.99
11_V	58_L	1.198	0.98
70_L	121_T	1.197	0.98
109_F	113_A	1.188	0.98
154_T	158_G	1.169	0.98
39_R	43_V	1.165	0.98
53_V	176_L	1.151	0.98
81_A	106_G	1.150	0.98
123_Y	131_E	1.150	0.98
19_N	23_G	1.143	0.98
112_S	164_A	1.141	0.98
18_A	22_L	1.138	0.98
15_V	18_A	1.119	0.98
73_V	135_T	1.118	0.98
30_A	86_A	1.106	0.97
63_A	122_A	1.096	0.97
8_R	11_V	1.093	0.97
136_T	139_A	1.083	0.97
208_G	212_A	1.081	0.97
161_G	189_A	1.062	0.97
189_A	193_V	1.057	0.97
11_V	54_V	1.055	0.97
34_P	86_A	1.055	0.97
125_T	170_T	1.041	0.96
85_V	89_G	1.036	0.96
140_T	210_A	1.036	0.96
202_F	218_P	1.032	0.96
200_G	204_K	1.019	0.96
28_V	107_A	1.018	0.96
141_L	214_L	1.016	0.96
12_A	58_L	1.007	0.95
109_F	142_L	0.996	0.95
84_V	156_I	0.978	0.95
133_V	173_Y	0.977	0.95
47_A	75_S	0.971	0.94
38_A	147_L	0.958	0.94
212_A	216_F	0.958	0.94
133_V	141_L	0.958	0.94
78_V	110_V	0.952	0.94
24_F	28_V	0.946	0.94
84_V	142_L	0.946	0.94
22_L	44_A	0.941	0.94
106_G	110_V	0.934	0.93
51_D	72_D	0.927	0.93
51_D	68_D	0.924	0.93
141_L	210_A	0.923	0.93
68_D	72_D	0.921	0.93
129_H	172_E	0.920	0.93
186_V	190_G	0.918	0.93
190_G	209_W	0.915	0.93
77_G	135_T	0.910	0.92
194_A	209_W	0.904	0.92
113_A	138_A	0.893	0.92
102_A	105_V	0.890	0.91
40_I	43_V	0.879	0.91
20_A	75_S	0.877	0.91
63_A	66_H	0.875	0.91
30_A	82_C	0.871	0.91
21_A	24_F	0.867	0.90
202_F	205_A	0.862	0.90
133_V	137_L	0.853	0.90
196_A	200_G	0.853	0.90
28_V	82_C	0.847	0.89
141_L	205_A	0.845	0.89
24_F	106_G	0.844	0.89
79_A	83_I	0.844	0.89
141_L	163_L	0.839	0.89
174_P	178_V	0.836	0.89
127_H	131_E	0.833	0.89
205_A	214_L	0.820	0.88
69_S	118_G	0.820	0.88
23_G	44_A	0.818	0.88
158_G	162_V	0.814	0.87
108_G	189_A	0.808	0.87
29_T	36_L	0.804	0.87
38_A	87_A	0.803	0.87
109_F	164_A	0.800	0.86
19_N	71_A	0.800	0.86
13_D	20_A	0.792	0.86
109_F	163_L	0.781	0.85
9_L	17_T	0.772	0.84
51_D	55_A	0.771	0.84
13_D	17_T	0.770	0.84
103_L	106_G	0.769	0.84
71_A	75_S	0.769	0.84
63_A	115_V	0.766	0.84
112_S	135_T	0.763	0.84
137_L	210_A	0.762	0.84
53_V	57_R	0.758	0.83
15_V	47_A	0.754	0.83
186_V	189_A	0.748	0.83
19_N	49_G	0.748	0.83
54_V	58_L	0.744	0.82
10_G	13_D	0.741	0.82
9_L	58_L	0.732	0.81
79_A	106_G	0.731	0.81
27_V	30_A	0.727	0.81
23_G	79_A	0.727	0.81
23_G	137_L	0.725	0.81
164_A	218_P	0.724	0.80
105_V	164_A	0.724	0.80
13_D	67_L	0.714	0.80
61_T	118_G	0.710	0.79
25_L	40_I	0.705	0.79
85_V	102_A	0.704	0.79
105_V	157_V	0.702	0.78
204_K	215_V	0.699	0.78
50_L	178_V	0.698	0.78
91_T	208_G	0.693	0.78
16_T	118_G	0.688	0.77
216_F	220_F	0.684	0.77
10_G	17_T	0.684	0.77
87_A	146_V	0.677	0.76
152_Q	156_I	0.676	0.76
15_V	53_V	0.675	0.76
26_A	40_I	0.675	0.76
149_G	152_Q	0.674	0.76
55_A	68_D	0.674	0.76
111_A	122_A	0.671	0.75
76_F	136_T	0.670	0.75
55_A	72_D	0.670	0.75
15_V	40_I	0.665	0.75
112_S	165_V	0.664	0.74
27_V	82_C	0.660	0.74
206_L	214_L	0.652	0.73
19_N	65_K	0.647	0.73
86_A	134_Q	0.645	0.72
211_G	215_V	0.643	0.72
66_H	125_T	0.643	0.72
45_A	76_F	0.638	0.72
189_A	194_A	0.638	0.72
22_L	65_K	0.637	0.71
118_G	121_T	0.637	0.71
114_V	118_G	0.636	0.71
205_A	208_G	0.636	0.71
135_T	163_L	0.633	0.71
166_L	218_P	0.633	0.71
157_V	160_A	0.631	0.71
89_G	106_G	0.630	0.71
113_A	205_A	0.629	0.70
174_P	220_F	0.627	0.70
71_A	84_V	0.623	0.70
216_F	219_R	0.623	0.70
167_M	173_Y	0.622	0.70
16_T	69_S	0.622	0.70
17_T	63_A	0.622	0.70
76_F	168_V	0.621	0.69
181_A	184_M	0.620	0.69
36_L	165_V	0.618	0.69
9_L	67_L	0.615	0.69
43_V	46_I	0.611	0.68
82_C	86_A	0.611	0.68
168_V	196_A	0.609	0.68
22_L	43_V	0.609	0.68
93_Q	128_E	0.608	0.68
118_G	136_T	0.605	0.67
123_Y	138_A	0.604	0.67
198_L	202_F	0.602	0.67
162_V	165_V	0.600	0.67
27_V	54_V	0.599	0.67
160_A	164_A	0.597	0.66
127_H	178_V	0.596	0.66
107_A	111_A	0.593	0.66
66_H	129_H	0.593	0.66
10_G	212_A	0.591	0.66
14_A	17_T	0.590	0.66
183_A	192_V	0.588	0.65
90_N	151_E	0.584	0.65
20_A	73_V	0.583	0.65
76_F	139_A	0.583	0.65
162_V	215_V	0.580	0.64
17_T	115_V	0.580	0.64
53_V	181_A	0.579	0.64
18_A	45_A	0.577	0.64
28_V	104_V	0.576	0.64
101_G	142_L	0.575	0.64
212_A	220_F	0.575	0.64
11_V	57_R	0.573	0.63
156_I	160_A	0.570	0.63
123_Y	126_G	0.570	0.63
130_T	137_L	0.566	0.62
186_V	191_A	0.564	0.62
13_D	61_T	0.563	0.62
71_A	207_F	0.563	0.62
32_S	85_V	0.562	0.62
108_G	152_Q	0.561	0.62
112_S	122_A	0.561	0.62
204_K	208_G	0.560	0.62
119_L	135_T	0.560	0.62
21_A	25_L	0.558	0.61
149_G	153_P	0.555	0.61
29_T	33_N	0.555	0.61
66_H	70_L	0.549	0.60
129_H	215_V	0.548	0.60
16_T	26_A	0.548	0.60
155_V	158_G	0.548	0.60
15_V	21_A	0.542	0.59
195_P	199_A	0.541	0.59
76_F	83_I	0.541	0.59
191_A	194_A	0.538	0.59
74_A	80_P	0.538	0.59
30_A	49_G	0.537	0.58
10_G	14_A	0.536	0.58
93_Q	161_G	0.536	0.58
69_S	76_F	0.535	0.58
66_H	69_S	0.534	0.58
183_A	188_Q	0.533	0.58
25_L	28_V	0.532	0.58
86_A	90_N	0.531	0.58
23_G	75_S	0.529	0.57
75_S	181_A	0.529	0.57
76_F	106_G	0.526	0.57
100_I	215_V	0.525	0.57
32_S	35_R	0.525	0.57
193_V	196_A	0.519	0.56
190_G	193_V	0.518	0.56
34_P	83_I	0.518	0.56
124_D	170_T	0.517	0.56
43_V	47_A	0.516	0.55
130_T	133_V	0.515	0.55
9_L	13_D	0.514	0.55
164_A	168_V	0.514	0.55
166_L	180_D	0.513	0.55
42_L	216_F	0.513	0.55
59_G	181_A	0.513	0.55
109_F	135_T	0.513	0.55
41_V	83_I	0.512	0.55
25_L	159_A	0.512	0.55
196_A	199_A	0.512	0.55
77_G	118_G	0.511	0.55
62_P	125_T	0.510	0.55
23_G	61_T	0.510	0.55
52_G	72_D	0.510	0.55
52_G	68_D	0.509	0.54
12_A	80_P	0.507	0.54
49_G	173_Y	0.506	0.54
70_L	114_V	0.505	0.54
71_A	126_G	0.504	0.54
175_D	198_L	0.504	0.54
74_A	114_V	0.503	0.54
197_A	203_P	0.500	0.53
166_L	169_S	0.500	0.53
204_K	207_F	0.500	0.53

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4mndA	2	0.7289	99.6	0.717	Contact Map
4o6mA	2	0.76	99.6	0.733	Contact Map
4q2eA	2	0.4	2.8	0.966	Contact Map
4kt0K	1	0.2267	2.6	0.967	Contact Map
3tx3A	2	0.7022	2	0.969	Contact Map
3l1lA	2	0.7289	1.7	0.97	Contact Map
4z7fA	2	0.2889	1.6	0.971	Contact Map
4ftgE	1	0.0711	1.1	0.973	Contact Map
2a65A	2	0.5111	1	0.974	Contact Map
2gsmB	1	0.3911	0.9	0.975	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.