Q9HRA6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HRA6 - Plastocyanin homology

UniProt:	Q9HRA6	Sequences: MHRRAFLAGGTTLSVGVLAGCIGPSVSKSDYDIGMVSNGFVPQEPVEGEDMATHQLTAGDTVTWANTGSRNHTVTAYGSGLPEGASYFASGGFDTEPDARRAWQDNVEGGGNISPGATYEVTLTVPGEYYYFCIPHEGAGMRGKLVVDD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (127)
Sequences:	466 (374)
Seq/√Len:	33.2

HALSA - Q9HRA6 Q9HRQ9 Q9HRS0 Q9HR99 P82857 Q9HQF3 Q9HN93

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
18_L	21_C	3.960	1.00
2_H	5_A	2.826	1.00
77_Y	137_E	2.717	1.00
62_V	123_L	2.598	1.00
8_A	12_T	2.440	1.00
54_H	145_L	2.352	0.99
56_L	123_L	2.339	0.99
26_V	29_S	2.229	0.99
133_C	136_H	2.200	0.99
58_A	126_P	2.172	0.99
54_H	60_D	1.993	0.98
62_V	131_Y	1.928	0.97
75_T	134_I	1.818	0.96
66_N	117_A	1.783	0.96
66_N	73_T	1.759	0.95
64_W	145_L	1.730	0.95
53_T	146_V	1.728	0.95
27_S	30_D	1.631	0.93
66_N	113_I	1.620	0.93
66_N	70_R	1.613	0.93
7_L	16_G	1.610	0.93
12_T	16_G	1.604	0.92
72_H	133_C	1.591	0.92
56_L	145_L	1.570	0.92
113_I	117_A	1.511	0.90
25_S	28_K	1.507	0.90
34_G	39_G	1.506	0.90
81_L	84_G	1.493	0.89
43_Q	48_G	1.492	0.89
134_I	142_R	1.490	0.89
55_Q	126_P	1.432	0.87
132_F	137_E	1.387	0.86
42_P	46_V	1.378	0.85
18_L	22_I	1.369	0.85
43_Q	46_V	1.353	0.84
54_H	64_W	1.314	0.82
135_P	140_G	1.313	0.82
53_T	144_K	1.309	0.82
128_E	146_V	1.304	0.82
42_P	145_L	1.299	0.82
134_I	137_E	1.297	0.82
38_N	47_E	1.292	0.81
117_A	138_G	1.277	0.80
76_A	79_S	1.274	0.80
5_A	8_A	1.272	0.80
64_W	131_Y	1.258	0.79
64_W	123_L	1.241	0.79
78_G	105_D	1.241	0.79
61_T	122_T	1.236	0.78
128_E	142_R	1.214	0.77
47_E	139_A	1.209	0.77
21_C	126_P	1.192	0.76
35_M	39_G	1.187	0.75
56_L	74_V	1.172	0.74
130_Y	144_K	1.167	0.74
66_N	75_T	1.159	0.74
40_F	43_Q	1.155	0.73
105_D	109_G	1.144	0.73
10_G	15_V	1.120	0.71
8_A	11_T	1.118	0.71
20_G	60_D	1.115	0.71
83_E	119_Y	1.086	0.69
11_T	14_S	1.080	0.68
39_G	43_Q	1.078	0.68
77_Y	132_F	1.075	0.68
51_M	72_H	1.075	0.68
61_T	120_E	1.073	0.68
127_G	147_V	1.050	0.66
79_S	132_F	1.050	0.66
55_Q	146_V	1.041	0.65
71_N	112_N	1.040	0.65
21_C	58_A	1.017	0.63
38_N	45_P	1.015	0.63
47_E	69_S	1.000	0.62
46_V	70_R	0.996	0.62
123_L	145_L	0.990	0.61
50_D	130_Y	0.966	0.59
73_T	111_G	0.951	0.58
132_F	138_G	0.949	0.58
70_R	73_T	0.944	0.58
55_Q	128_E	0.933	0.57
79_S	82_P	0.911	0.55
23_G	29_S	0.908	0.55
75_T	111_G	0.907	0.54
71_N	116_G	0.903	0.54
130_Y	146_V	0.897	0.54
23_G	128_E	0.894	0.53
5_A	21_C	0.855	0.50
2_H	9_G	0.851	0.50
47_E	116_G	0.840	0.49
73_T	134_I	0.832	0.48
8_A	146_V	0.828	0.48
81_L	117_A	0.828	0.48
121_V	129_Y	0.827	0.48
135_P	141_M	0.826	0.48
55_Q	144_K	0.812	0.47
49_E	73_T	0.804	0.46
73_T	77_Y	0.798	0.45
5_A	18_L	0.797	0.45
114_S	117_A	0.781	0.44
7_L	11_T	0.775	0.44
36_V	54_H	0.771	0.43
10_G	63_T	0.762	0.42
48_G	52_A	0.759	0.42
27_S	31_Y	0.756	0.42
14_S	31_Y	0.751	0.42
9_G	12_T	0.746	0.41
76_A	121_V	0.737	0.40
130_Y	142_R	0.735	0.40
35_M	40_F	0.735	0.40
121_V	124_T	0.733	0.40
129_Y	132_F	0.727	0.40
34_G	115_P	0.726	0.40
25_S	29_S	0.719	0.39
64_W	74_V	0.717	0.39
109_G	112_N	0.716	0.39
32_D	56_L	0.716	0.39
35_M	38_N	0.714	0.39
47_E	115_P	0.704	0.38
102_A	105_D	0.701	0.38
42_P	48_G	0.690	0.37
75_T	132_F	0.675	0.36
18_L	30_D	0.668	0.35
18_L	58_A	0.668	0.35
109_G	113_I	0.667	0.35
65_A	139_A	0.667	0.35
76_A	80_G	0.665	0.35
16_G	19_A	0.660	0.34
46_V	145_L	0.658	0.34
10_G	13_L	0.657	0.34
62_V	143_G	0.656	0.34
13_L	143_G	0.656	0.34
37_S	125_V	0.651	0.34
82_P	119_Y	0.650	0.34
103_W	119_Y	0.649	0.34
11_T	16_G	0.648	0.34
68_G	140_G	0.646	0.33
43_Q	67_T	0.642	0.33
73_T	135_P	0.638	0.33
64_W	121_V	0.634	0.32
57_T	60_D	0.622	0.32
8_A	17_V	0.622	0.32
25_S	54_H	0.619	0.31
68_G	109_G	0.619	0.31
28_K	32_D	0.610	0.31
104_Q	132_F	0.610	0.31
3_R	7_L	0.609	0.31
34_G	43_Q	0.605	0.30
56_L	60_D	0.596	0.30
103_W	139_A	0.596	0.30
3_R	6_F	0.595	0.30
20_G	68_G	0.591	0.29
136_H	141_M	0.591	0.29
64_W	119_Y	0.590	0.29
85_A	121_V	0.584	0.29
16_G	24_P	0.584	0.29
59_G	133_C	0.581	0.29
21_C	56_L	0.579	0.29
5_A	9_G	0.578	0.29
11_T	142_R	0.576	0.28
47_E	146_V	0.575	0.28
2_H	17_V	0.573	0.28
80_G	84_G	0.572	0.28
60_D	118_T	0.570	0.28
69_S	113_I	0.568	0.28
64_W	68_G	0.567	0.28
34_G	41_V	0.561	0.27
114_S	119_Y	0.559	0.27
14_S	56_L	0.552	0.27
28_K	31_Y	0.551	0.27
78_G	81_L	0.544	0.26
80_G	119_Y	0.543	0.26
70_R	113_I	0.541	0.26
80_G	132_F	0.538	0.26
59_G	136_H	0.537	0.26
51_M	145_L	0.528	0.25
68_G	85_A	0.527	0.25
38_N	41_V	0.526	0.25
13_L	124_T	0.523	0.25
128_E	144_K	0.521	0.25
15_V	134_I	0.520	0.25
53_T	60_D	0.520	0.25
72_H	136_H	0.519	0.25
68_G	144_K	0.515	0.24
6_F	33_I	0.515	0.24
13_L	110_G	0.509	0.24
109_G	117_A	0.507	0.24
82_P	129_Y	0.504	0.24
24_P	56_L	0.503	0.24
59_G	127_G	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75A	1	0.6846	99.9	0.455	Contact Map
1iuzA	1	0.6577	99.8	0.567	Contact Map
1bypA	1	0.6644	99.8	0.567	Contact Map
3ef4A	1	0.6174	99.8	0.568	Contact Map
1pazA	1	0.6309	99.8	0.569	Contact Map
1pmyA	1	0.6309	99.8	0.571	Contact Map
3erxA	3	0.6309	99.7	0.573	Contact Map
2pltA	1	0.6577	99.7	0.574	Contact Map
1pcsA	2	0.6577	99.7	0.575	Contact Map
2ov0A	1	0.7047	99.7	0.577	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.