RS15 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS15 - 30S ribosomal protein S15

UniProt:	Q9HRA2	Sequences: MARMHTRRRGSSGSDRPTADEPPEWSDVDEDAIEERVVELAEQGHDPSQIGLKLRDEGVQGTPVPDVKLATGKKVTEILEAHDAEPELPEDFRNLLEKAVRLHEHVEANGQDHQNKRALQNTQSKIRRLADYYRGDKLDEEFAYSYETAREIIEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (149)
Sequences:	379 (205)
Seq/√Len:	16.8

HALSA - RS15
SULSO - RS15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
102_L	122_T	6.906	1.00
71_T	78_I	4.822	1.00
73_K	81_A	3.996	1.00
138_L	142_F	3.022	0.99
2_A	8_R	2.646	0.97
103_H	146_Y	2.528	0.96
5_H	102_L	2.486	0.95
102_L	115_N	2.443	0.95
37_V	78_I	2.435	0.95
16_R	66_D	2.285	0.93
26_S	70_A	2.208	0.91
123_Q	144_Y	2.183	0.91
150_R	153_I	2.123	0.89
57_E	67_V	1.899	0.83
88_L	137_K	1.839	0.81
26_S	65_P	1.823	0.81
34_E	38_V	1.780	0.79
36_R	136_D	1.740	0.77
67_V	78_I	1.719	0.76
1_M	5_H	1.707	0.76
110_G	125_K	1.689	0.75
28_V	64_V	1.625	0.72
31_D	34_E	1.601	0.71
148_T	152_I	1.600	0.71
122_T	125_K	1.581	0.70
38_V	82_H	1.579	0.70
42_E	84_A	1.554	0.69
36_R	39_E	1.551	0.68
43_Q	124_S	1.548	0.68
17_P	41_A	1.521	0.67
98_K	110_G	1.499	0.66
26_S	29_D	1.449	0.63
48_S	74_K	1.426	0.62
99_A	144_Y	1.418	0.61
75_V	102_L	1.400	0.60
119_L	123_Q	1.382	0.59
34_E	136_D	1.377	0.59
139_D	142_F	1.351	0.57
101_R	118_A	1.311	0.55
48_S	90_E	1.307	0.55
35_E	39_E	1.298	0.54
55_R	90_E	1.244	0.51
82_H	137_K	1.239	0.51
26_S	32_A	1.234	0.51
107_E	116_K	1.221	0.50
37_V	71_T	1.200	0.49
17_P	127_R	1.183	0.47
21_E	33_I	1.169	0.47
38_V	87_E	1.159	0.46
32_A	134_R	1.157	0.46
116_K	120_Q	1.152	0.46
65_P	117_R	1.131	0.44
26_S	69_L	1.118	0.44
57_E	136_D	1.116	0.44
104_E	109_N	1.106	0.43
57_E	65_P	1.101	0.43
87_E	153_I	1.098	0.43
41_A	86_P	1.095	0.42
109_N	146_Y	1.094	0.42
36_R	40_L	1.086	0.42
40_L	67_V	1.062	0.40
88_L	153_I	1.060	0.40
104_E	107_E	1.054	0.40
12_S	87_E	1.053	0.40
143_A	151_E	1.052	0.40
97_E	113_H	1.050	0.40
12_S	34_E	1.040	0.39
93_R	97_E	1.036	0.39
9_R	124_S	1.034	0.39
7_R	16_R	1.030	0.39
100_V	153_I	1.013	0.38
99_A	123_Q	1.009	0.37
29_D	38_V	1.009	0.37
2_A	7_R	1.006	0.37
12_S	141_E	0.998	0.37
48_S	69_L	0.994	0.37
104_E	151_E	0.992	0.36
103_H	120_Q	0.988	0.36
130_A	142_F	0.982	0.36
114_Q	118_A	0.974	0.36
126_I	144_Y	0.970	0.35
42_E	142_F	0.969	0.35
22_P	28_V	0.935	0.33
145_S	148_T	0.928	0.33
91_D	133_Y	0.925	0.33
1_M	4_M	0.924	0.33
65_P	125_K	0.922	0.33
37_V	50_I	0.920	0.33
142_F	151_E	0.908	0.32
123_Q	126_I	0.901	0.32
9_R	131_D	0.874	0.30
98_K	114_Q	0.872	0.30
6_T	135_G	0.870	0.30
8_R	125_K	0.868	0.30
77_E	80_E	0.867	0.30
105_H	112_D	0.862	0.30
144_Y	149_A	0.850	0.29
67_V	111_Q	0.849	0.29
18_T	80_E	0.846	0.29
80_E	85_E	0.841	0.29
20_D	131_D	0.836	0.28
80_E	136_D	0.833	0.28
2_A	9_R	0.823	0.28
74_K	96_L	0.823	0.28
58_G	64_V	0.822	0.28
76_T	85_E	0.820	0.28
16_R	49_Q	0.814	0.27
64_V	68_K	0.797	0.27
72_G	95_L	0.796	0.27
53_K	106_V	0.795	0.26
66_D	69_L	0.788	0.26
63_P	131_D	0.784	0.26
34_E	94_N	0.779	0.26
36_R	58_G	0.777	0.26
2_A	100_V	0.776	0.26
87_E	106_V	0.762	0.25
43_Q	116_K	0.760	0.25
29_D	145_S	0.755	0.25
47_P	76_T	0.750	0.24
16_R	68_K	0.749	0.24
27_D	127_R	0.745	0.24
17_P	119_L	0.745	0.24
99_A	126_I	0.744	0.24
111_Q	136_D	0.742	0.24
39_E	77_E	0.741	0.24
19_A	137_K	0.735	0.24
16_R	75_V	0.735	0.24
114_Q	131_D	0.730	0.24
64_V	96_L	0.728	0.23
127_R	150_R	0.726	0.23
74_K	93_R	0.723	0.23
36_R	66_D	0.721	0.23
24_E	39_E	0.720	0.23
149_A	152_I	0.716	0.23
17_P	124_S	0.715	0.23
141_E	146_Y	0.711	0.23
25_W	56_D	0.711	0.23
45_H	49_Q	0.708	0.23
114_Q	117_R	0.705	0.23
11_S	70_A	0.704	0.22
3_R	10_G	0.702	0.22
148_T	153_I	0.699	0.22
4_M	74_K	0.699	0.22
43_Q	115_N	0.694	0.22
11_S	78_I	0.693	0.22
29_D	76_T	0.693	0.22
16_R	108_A	0.692	0.22
91_D	129_L	0.692	0.22
28_V	58_G	0.690	0.22
115_N	124_S	0.690	0.22
5_H	135_G	0.686	0.22
21_E	34_E	0.682	0.22
33_I	153_I	0.680	0.22
1_M	6_T	0.674	0.21
75_V	135_G	0.669	0.21
103_H	130_A	0.662	0.21
116_K	149_A	0.651	0.20
12_S	76_T	0.647	0.20
41_A	47_P	0.636	0.20
83_D	131_D	0.633	0.20
96_L	152_I	0.630	0.20
66_D	71_T	0.628	0.19
119_L	144_Y	0.625	0.19
134_R	143_A	0.621	0.19
2_A	95_L	0.616	0.19
103_H	119_L	0.615	0.19
31_D	58_G	0.611	0.19
12_S	82_H	0.607	0.19
93_R	113_H	0.605	0.19
30_E	64_V	0.603	0.19
7_R	150_R	0.601	0.19
64_V	73_K	0.599	0.18
110_G	122_T	0.598	0.18
80_E	124_S	0.598	0.18
11_S	81_A	0.598	0.18
38_V	65_P	0.596	0.18
69_L	78_I	0.596	0.18
48_S	76_T	0.593	0.18
124_S	131_D	0.592	0.18
63_P	146_Y	0.592	0.18
115_N	145_S	0.591	0.18
79_L	104_E	0.588	0.18
22_P	137_K	0.587	0.18
34_E	82_H	0.584	0.18
32_A	136_D	0.584	0.18
2_A	101_R	0.580	0.18
79_L	85_E	0.579	0.18
12_S	50_I	0.579	0.18
39_E	73_K	0.578	0.18
55_R	112_D	0.575	0.18
23_P	55_R	0.572	0.17
110_G	118_A	0.570	0.17
70_A	151_E	0.570	0.17
78_I	126_I	0.569	0.17
85_E	88_L	0.568	0.17
46_D	109_N	0.567	0.17
25_W	65_P	0.563	0.17
75_V	147_E	0.553	0.17
38_V	126_I	0.551	0.17
25_W	72_G	0.547	0.17
64_V	81_A	0.546	0.17
4_M	10_G	0.545	0.17
10_G	17_P	0.545	0.17
72_G	113_H	0.540	0.16
70_A	79_L	0.538	0.16
42_E	63_P	0.538	0.16
4_M	7_R	0.537	0.16
10_G	14_S	0.536	0.16
9_R	40_L	0.533	0.16
45_H	136_D	0.533	0.16
43_Q	97_E	0.533	0.16
43_Q	117_R	0.531	0.16
24_E	143_A	0.530	0.16
85_E	124_S	0.526	0.16
47_P	77_E	0.520	0.16
69_L	73_K	0.520	0.16
55_R	65_P	0.519	0.16
19_A	103_H	0.515	0.16
125_K	150_R	0.512	0.16
12_S	115_N	0.508	0.15
100_V	149_A	0.506	0.15
64_V	67_V	0.505	0.15
99_A	119_L	0.500	0.15
34_E	73_K	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j7aU	1	0.9548	100	0.131	Contact Map
3zeyG	1	0.9032	100	0.132	Contact Map
4bpeO	1	0.9613	100	0.14	Contact Map
4ujpO	1	0.9613	100	0.149	Contact Map
3j20Q	1	0.9677	100	0.306	Contact Map
5aj3O	1	0.6839	98.6	0.851	Contact Map
4iylA	3	0.5032	97.7	0.881	Contact Map
4a5uB	1	0.4581	97.6	0.884	Contact Map
3bbnO	1	0.5032	97.6	0.884	Contact Map
4rb5O	1	0.5097	97.4	0.889	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.