Q9HR99 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR99 - Halocyanin-like

UniProt:	Q9HR99	Sequences: MLKSTGAAVTATLLAGCSGGGDTGDDESDSESGEEATGNEAGGGEEASQSGGNTIAVAPDGGFKFEPSELTVSVGDTVTWEFEESSHNVSAWPDMHDKISIPDGASGFGTMDKDGNQFAVVDAGETLEHTFETAGEYTYVCMPHVASGMIGTVVVEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (131)
Sequences:	416 (359)
Seq/√Len:	31.4

HALSA - Q9HR99 Q9HRQ9 Q9HRA6 Q9HQF3 Q9HRS0 Q9HN93 P82857

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_L	17_C	4.136	1.00
78_V	131_F	3.436	1.00
91_A	110_T	3.113	1.00
111_M	127_L	2.545	1.00
73_S	156_E	2.539	1.00
59_P	62_G	2.505	0.99
88_N	143_P	2.466	0.99
131_F	153_V	2.447	0.99
87_H	141_C	2.328	0.99
14_L	19_G	2.189	0.99
91_A	111_M	2.165	0.98
87_H	144_H	2.161	0.98
136_E	156_E	2.109	0.98
71_T	156_E	1.975	0.97
80_W	153_V	1.940	0.97
143_P	148_G	1.909	0.97
34_E	41_A	1.871	0.96
54_T	81_E	1.861	0.96
80_W	139_Y	1.854	0.96
82_F	88_N	1.783	0.95
82_F	125_E	1.739	0.94
17_C	20_G	1.728	0.94
49_Q	73_S	1.685	0.93
78_V	139_Y	1.625	0.92
33_G	37_T	1.615	0.92
38_G	42_G	1.584	0.91
63_F	85_S	1.501	0.88
59_P	64_K	1.450	0.86
55_I	58_A	1.438	0.86
69_E	154_V	1.396	0.84
34_E	38_G	1.363	0.83
72_V	131_F	1.356	0.82
57_V	82_F	1.352	0.82
80_W	131_F	1.318	0.81
23_T	27_E	1.302	0.80
83_E	133_T	1.288	0.79
72_V	153_V	1.287	0.79
47_A	50_S	1.251	0.77
34_E	40_E	1.246	0.77
17_C	21_G	1.208	0.74
19_G	24_G	1.181	0.73
102_P	133_T	1.162	0.71
16_G	20_G	1.149	0.71
90_S	142_M	1.126	0.69
127_L	131_F	1.122	0.69
22_D	65_F	1.120	0.69
77_T	128_E	1.119	0.69
140_V	153_V	1.110	0.68
129_H	132_E	1.104	0.67
90_S	112_D	1.096	0.67
134_A	156_E	1.091	0.67
71_T	154_V	1.082	0.66
20_G	28_S	1.076	0.65
112_D	119_A	1.071	0.65
103_D	110_T	1.059	0.64
40_E	44_G	1.052	0.64
80_W	127_L	1.050	0.64
34_E	42_G	1.048	0.63
102_P	111_M	1.047	0.63
140_V	146_A	1.042	0.63
32_S	41_A	1.038	0.63
14_L	20_G	1.038	0.63
35_E	41_A	1.013	0.61
70_L	80_W	1.007	0.60
61_G	104_G	1.006	0.60
91_A	148_G	1.004	0.60
9_V	23_T	0.998	0.60
44_G	47_A	0.996	0.59
21_G	25_D	0.992	0.59
38_G	43_G	0.990	0.59
80_W	129_H	0.986	0.59
26_D	30_S	0.974	0.58
37_T	40_E	0.958	0.56
118_F	121_V	0.957	0.56
65_F	122_D	0.955	0.56
21_G	26_D	0.950	0.56
59_P	154_V	0.948	0.56
27_E	31_E	0.945	0.55
111_M	137_Y	0.937	0.55
20_G	29_D	0.929	0.54
63_F	147_S	0.922	0.53
28_S	31_E	0.917	0.53
38_G	41_A	0.871	0.49
17_C	22_D	0.843	0.47
13_L	16_G	0.843	0.47
23_T	31_E	0.835	0.46
141_C	144_H	0.835	0.46
88_N	148_G	0.834	0.46
45_E	48_S	0.831	0.46
90_S	145_V	0.830	0.46
55_I	80_W	0.827	0.46
62_G	122_D	0.825	0.46
7_A	12_T	0.821	0.45
23_T	30_S	0.809	0.44
40_E	46_E	0.802	0.44
13_L	54_T	0.800	0.44
36_A	47_A	0.797	0.43
72_V	149_M	0.793	0.43
137_Y	140_V	0.788	0.43
88_N	119_A	0.786	0.42
7_A	10_T	0.783	0.42
26_D	47_A	0.779	0.42
10_T	38_G	0.774	0.42
74_V	134_A	0.772	0.41
122_D	125_E	0.767	0.41
75_G	139_Y	0.766	0.41
25_D	30_S	0.764	0.41
54_T	58_A	0.762	0.41
7_A	13_L	0.762	0.41
86_S	122_D	0.760	0.40
70_L	153_V	0.759	0.40
48_S	71_T	0.754	0.40
21_G	31_E	0.754	0.40
55_I	70_L	0.751	0.40
44_G	48_S	0.750	0.40
35_E	40_E	0.750	0.40
71_T	136_E	0.748	0.39
18_S	26_D	0.744	0.39
121_V	125_E	0.744	0.39
33_G	36_A	0.742	0.39
46_E	49_Q	0.741	0.39
123_A	128_E	0.741	0.39
66_E	138_T	0.738	0.39
53_N	58_A	0.736	0.39
85_S	121_V	0.730	0.38
82_F	118_F	0.725	0.38
33_G	38_G	0.725	0.38
125_E	146_A	0.712	0.37
51_G	128_E	0.696	0.36
91_A	129_H	0.696	0.36
57_V	89_V	0.694	0.35
90_S	119_A	0.694	0.35
104_G	124_G	0.693	0.35
58_A	88_N	0.692	0.35
22_D	28_S	0.689	0.35
92_W	111_M	0.687	0.35
30_S	78_V	0.677	0.34
19_G	23_T	0.673	0.34
59_P	63_F	0.671	0.34
21_G	24_G	0.670	0.34
92_W	145_V	0.670	0.34
71_T	134_A	0.666	0.33
32_S	37_T	0.662	0.33
17_C	26_D	0.661	0.33
34_E	37_T	0.660	0.33
16_G	23_T	0.655	0.33
31_E	37_T	0.654	0.32
65_F	79_T	0.651	0.32
79_T	125_E	0.647	0.32
138_T	152_T	0.643	0.32
85_S	123_A	0.642	0.32
104_G	133_T	0.641	0.32
40_E	48_S	0.641	0.32
80_W	91_A	0.634	0.31
112_D	118_F	0.634	0.31
80_W	84_E	0.632	0.31
72_V	89_V	0.630	0.31
42_G	48_S	0.628	0.31
67_P	143_P	0.625	0.30
74_V	156_E	0.622	0.30
84_E	148_G	0.620	0.30
63_F	76_D	0.611	0.29
10_T	17_C	0.610	0.29
36_A	45_E	0.604	0.29
70_L	136_E	0.597	0.29
112_D	122_D	0.586	0.28
57_V	84_E	0.581	0.28
129_H	137_Y	0.580	0.27
102_P	110_T	0.580	0.27
14_L	23_T	0.568	0.27
61_G	147_S	0.566	0.27
16_G	19_G	0.564	0.26
43_G	62_G	0.555	0.26
145_V	150_I	0.554	0.26
9_V	14_L	0.553	0.26
15_A	19_G	0.553	0.26
63_F	143_P	0.546	0.25
60_D	65_F	0.546	0.25
131_F	139_Y	0.539	0.25
55_I	143_P	0.535	0.25
84_E	145_V	0.530	0.24
31_E	44_G	0.529	0.24
59_P	147_S	0.526	0.24
80_W	111_M	0.522	0.24
43_G	128_E	0.519	0.24
36_A	41_A	0.517	0.24
88_N	150_I	0.515	0.23
7_A	30_S	0.508	0.23
68_S	80_W	0.505	0.23
13_L	18_S	0.504	0.23
53_N	57_V	0.503	0.23
25_D	31_E	0.503	0.23
58_A	153_V	0.503	0.23
55_I	151_G	0.501	0.23
55_I	60_D	0.500	0.23
63_F	154_V	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3c75A	1	0.6688	99.9	0.499	Contact Map
3ef4A	1	0.5796	99.8	0.531	Contact Map
1iuzA	1	0.6115	99.8	0.537	Contact Map
3erxA	3	0.5796	99.8	0.54	Contact Map
1kdjA	1	0.6051	99.8	0.54	Contact Map
1pazA	1	0.5796	99.8	0.54	Contact Map
1pmyA	1	0.5796	99.8	0.541	Contact Map
1bypA	1	0.6115	99.8	0.541	Contact Map
2ux6A	1	0.5669	99.8	0.542	Contact Map
2pltA	1	0.6115	99.8	0.543	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.