DMSD - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DMSD - Putative dimethyl sulfoxide reductase chaperone

UniProt:	Q9HR71	Sequences: MTPATRNNDSAVAVADAFDDTGDGPPTAARFAALAACWRQPDDDLQAALAAETDTTVDAQSLRAEYTRLFVGPGPSQSPPYESVYRDGERDADLGPVYGSSTQAVARWYSEYGLQPAASESAPPDHLATELEFAAYLREHEGAETLEQFLTEHPRNWVESFARRVRDADPKPFYRTLLNVTVDTLARADTPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	192 (161)
Sequences:	1317 (998)
Seq/√Len:	78.6

ECOLI - DMSD TORD
HALSA - DMSD
SULSO - Q97XY2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_Y	133_F	3.928	1.00
38_W	181_T	3.316	1.00
65_E	171_K	2.956	1.00
106_A	124_P	2.918	1.00
82_E	153_H	2.573	1.00
161_F	165_V	2.470	1.00
162_A	181_T	2.459	1.00
27_T	146_L	2.456	1.00
127_L	158_V	2.429	1.00
166_R	182_V	2.385	1.00
87_D	99_G	2.357	1.00
158_V	185_L	2.307	1.00
27_T	188_A	2.253	1.00
134_A	146_L	2.242	1.00
27_T	31_F	2.203	1.00
39_R	128_A	2.128	1.00
166_R	179_N	2.106	1.00
31_F	188_A	2.081	1.00
112_Y	145_T	2.008	1.00
67_T	71_V	1.990	1.00
85_Y	164_R	1.879	1.00
62_L	173_F	1.874	1.00
82_E	130_E	1.852	1.00
133_F	149_F	1.804	1.00
34_L	181_T	1.791	1.00
148_Q	152_E	1.791	1.00
138_R	146_L	1.758	1.00
82_E	86_R	1.742	1.00
43_D	47_A	1.714	1.00
80_P	161_F	1.695	1.00
38_W	177_L	1.694	1.00
165_V	178_L	1.642	1.00
114_L	136_Y	1.591	1.00
151_T	189_D	1.568	0.99
32_A	139_E	1.565	0.99
158_V	162_A	1.562	0.99
105_V	130_E	1.550	0.99
105_V	109_Y	1.541	0.99
37_C	177_L	1.530	0.99
172_P	175_R	1.516	0.99
31_F	184_T	1.514	0.99
35_A	132_E	1.513	0.99
32_A	135_A	1.501	0.99
82_E	105_V	1.479	0.99
134_A	150_L	1.466	0.99
65_E	169_D	1.444	0.99
135_A	139_E	1.436	0.99
63_R	67_T	1.395	0.99
131_L	185_L	1.386	0.99
159_E	182_V	1.382	0.99
134_A	184_T	1.375	0.99
82_E	156_N	1.368	0.99
31_F	146_L	1.360	0.99
41_P	66_Y	1.298	0.98
73_P	76_S	1.274	0.98
127_L	161_F	1.273	0.98
138_R	141_E	1.205	0.97
182_V	186_A	1.198	0.97
66_Y	126_H	1.180	0.96
138_R	188_A	1.175	0.96
28_A	139_E	1.174	0.96
36_A	42_D	1.168	0.96
130_E	133_F	1.155	0.96
127_L	162_A	1.138	0.96
27_T	184_T	1.133	0.95
111_E	148_Q	1.112	0.95
169_D	172_P	1.100	0.95
163_R	182_V	1.083	0.94
154_P	158_V	1.081	0.94
38_W	70_F	1.076	0.94
102_T	124_P	1.076	0.94
83_S	123_P	1.058	0.93
81_Y	122_A	1.057	0.93
127_L	181_T	1.055	0.93
79_P	84_V	1.048	0.93
85_Y	174_Y	1.024	0.92
177_L	181_T	1.013	0.92
38_W	127_L	1.006	0.92
27_T	134_A	0.997	0.91
42_D	48_A	0.995	0.91
100_S	104_A	0.976	0.90
58_D	61_S	0.962	0.90
131_L	181_T	0.956	0.89
27_T	138_R	0.956	0.89
81_Y	98_Y	0.955	0.89
105_V	149_F	0.952	0.89
40_Q	71_V	0.944	0.89
160_S	164_R	0.930	0.88
102_T	106_A	0.926	0.88
102_T	105_V	0.925	0.88
57_V	62_L	0.920	0.88
37_C	173_F	0.919	0.88
169_D	175_R	0.917	0.87
50_A	55_T	0.916	0.87
157_W	161_F	0.907	0.87
71_V	76_S	0.906	0.87
43_D	59_A	0.903	0.87
176_T	180_V	0.900	0.86
126_H	129_T	0.883	0.85
69_L	180_V	0.879	0.85
72_G	76_S	0.868	0.84
84_V	89_E	0.867	0.84
107_R	111_E	0.867	0.84
130_E	149_F	0.852	0.83
155_R	185_L	0.850	0.83
31_F	134_A	0.848	0.83
36_A	62_L	0.847	0.83
80_P	127_L	0.847	0.83
163_R	166_R	0.845	0.83
104_A	152_E	0.842	0.83
176_T	183_D	0.838	0.82
112_Y	133_F	0.833	0.82
66_Y	70_F	0.820	0.81
41_P	45_L	0.812	0.80
87_D	101_S	0.811	0.80
111_E	118_A	0.808	0.80
111_E	145_T	0.803	0.79
59_A	63_R	0.798	0.79
156_N	159_E	0.791	0.78
109_Y	129_T	0.785	0.78
40_Q	67_T	0.779	0.77
149_F	157_W	0.777	0.77
65_E	68_R	0.771	0.77
109_Y	130_E	0.771	0.77
160_S	163_R	0.767	0.76
153_H	156_N	0.757	0.75
40_Q	59_A	0.751	0.75
81_Y	123_P	0.749	0.75
86_R	156_N	0.743	0.74
65_E	175_R	0.740	0.74
130_E	154_P	0.731	0.73
70_F	165_V	0.725	0.72
98_Y	123_P	0.725	0.72
35_A	81_Y	0.721	0.72
64_A	67_T	0.721	0.72
146_L	188_A	0.718	0.71
130_E	141_E	0.717	0.71
30_R	36_A	0.716	0.71
78_S	84_V	0.715	0.71
54_D	58_D	0.715	0.71
73_P	81_Y	0.712	0.71
144_E	148_Q	0.711	0.71
61_S	141_E	0.709	0.70
134_A	188_A	0.703	0.70
184_T	188_A	0.702	0.70
39_R	129_T	0.701	0.70
78_S	165_V	0.699	0.69
37_C	97_V	0.698	0.69
83_S	97_V	0.690	0.68
105_V	133_F	0.687	0.68
150_L	155_R	0.685	0.68
60_Q	64_A	0.679	0.67
35_A	135_A	0.672	0.66
41_P	174_Y	0.668	0.66
40_Q	99_G	0.667	0.66
34_L	184_T	0.664	0.65
162_A	178_L	0.664	0.65
108_W	149_F	0.660	0.65
69_L	168_A	0.655	0.64
167_D	179_N	0.649	0.64
72_G	123_P	0.645	0.63
78_S	85_Y	0.645	0.63
37_C	180_V	0.641	0.63
178_L	181_T	0.641	0.63
154_P	177_L	0.640	0.63
30_R	53_T	0.639	0.62
47_A	54_D	0.638	0.62
25_P	29_A	0.635	0.62
85_Y	160_S	0.634	0.62
108_W	112_Y	0.634	0.62
150_L	188_A	0.629	0.61
83_S	101_S	0.623	0.60
65_E	77_Q	0.616	0.60
164_R	167_D	0.614	0.59
136_Y	139_E	0.612	0.59
47_A	59_A	0.610	0.59
149_F	153_H	0.608	0.59
73_P	102_T	0.606	0.58
24_G	141_E	0.605	0.58
51_A	170_P	0.604	0.58
179_N	186_A	0.603	0.58
24_G	28_A	0.601	0.58
32_A	132_E	0.596	0.57
130_E	153_H	0.594	0.57
51_A	177_L	0.594	0.57
28_A	135_A	0.594	0.57
98_Y	102_T	0.591	0.57
109_Y	149_F	0.589	0.56
166_R	175_R	0.588	0.56
132_E	136_Y	0.587	0.56
40_Q	62_L	0.583	0.55
71_V	126_H	0.583	0.55
108_W	148_Q	0.579	0.55
112_Y	137_L	0.578	0.55
77_Q	168_A	0.577	0.55
49_L	182_V	0.575	0.54
136_Y	140_H	0.573	0.54
131_L	159_E	0.571	0.54
135_A	167_D	0.571	0.54
170_P	186_A	0.564	0.53
126_H	161_F	0.562	0.53
114_L	139_E	0.556	0.52
50_A	54_D	0.554	0.52
82_E	99_G	0.553	0.52
86_R	101_S	0.550	0.51
109_Y	124_P	0.550	0.51
65_E	165_V	0.550	0.51
36_A	39_R	0.549	0.51
103_Q	124_P	0.548	0.51
80_P	123_P	0.544	0.50
33_A	49_L	0.539	0.50
30_R	147_E	0.537	0.50
33_A	37_C	0.536	0.49
61_S	82_E	0.534	0.49
118_A	121_S	0.532	0.49
78_S	158_V	0.531	0.49
155_R	188_A	0.530	0.49
162_A	182_V	0.528	0.48
59_A	62_L	0.528	0.48
28_A	142_G	0.526	0.48
81_Y	102_T	0.525	0.48
82_E	101_S	0.524	0.48
67_T	105_V	0.523	0.48
37_C	60_Q	0.521	0.48
84_V	102_T	0.520	0.47
30_R	184_T	0.518	0.47
52_E	75_P	0.517	0.47
71_V	80_P	0.517	0.47
143_A	158_V	0.517	0.47
105_V	138_R	0.516	0.47
44_D	48_A	0.516	0.47
72_G	83_S	0.516	0.47
25_P	47_A	0.515	0.47
97_V	102_T	0.514	0.47
68_R	161_F	0.514	0.47
143_A	147_E	0.510	0.46
62_L	174_Y	0.509	0.46
111_E	170_P	0.509	0.46
162_A	166_R	0.505	0.45
65_E	108_W	0.502	0.45
73_P	98_Y	0.502	0.45
31_F	132_E	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1n1cA	2	0.8385	100	0.265	Contact Map
1s9uA	1	0.8698	100	0.28	Contact Map
2o9xA	2	0.7812	100	0.377	Contact Map
2xolA	2	0.7135	100	0.437	Contact Map
2hlyA	1	0.5365	4.2	0.955	Contact Map
3wurA	2	0.7604	3.2	0.957	Contact Map
2dgwA	1	0.4635	2.7	0.959	Contact Map
3q0wA	2	0.474	2.7	0.959	Contact Map
4cv5B	1	0.7083	2.6	0.959	Contact Map
4jzaA	2	0.4427	2.3	0.96	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.