Q9HR55 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR55 - Uncharacterized protein

UniProt:	Q9HR55	Sequences: MNPPFGAQDGAEHADRAFLAAASEVAAVSYSVHNAGSKAFVESFAGDRGGTVTHAFAAEFAVPAQFSFHTQDRAVLDVELFRVDWGRQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	89 (82)
Sequences:	136 (97)
Seq/√Len:	10.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_A	24_E	3.720	0.98
37_S	79_E	2.545	0.87
41_V	81_F	2.305	0.81
66_F	72_D	2.169	0.76
64_A	72_D	2.155	0.76
19_L	44_F	2.115	0.74
7_A	34_N	2.112	0.74
36_G	79_E	2.059	0.72
70_T	80_L	1.925	0.67
53_T	82_R	1.893	0.66
62_V	70_T	1.874	0.65
41_V	75_V	1.802	0.62
71_Q	74_A	1.791	0.61
20_A	44_F	1.738	0.59
22_A	64_A	1.655	0.55
46_G	51_T	1.654	0.55
54_H	82_R	1.598	0.52
28_V	53_T	1.513	0.48
34_N	83_V	1.494	0.47
8_Q	68_F	1.492	0.47
61_A	65_Q	1.385	0.42
21_A	83_V	1.373	0.42
61_A	64_A	1.363	0.41
36_G	64_A	1.346	0.40
28_V	82_R	1.330	0.40
16_R	32_V	1.305	0.38
62_V	74_A	1.288	0.38
13_H	60_F	1.280	0.37
19_L	83_V	1.248	0.36
19_L	81_F	1.246	0.36
42_E	55_A	1.245	0.36
31_S	44_F	1.244	0.36
77_D	80_L	1.239	0.36
68_F	75_V	1.225	0.35
7_A	37_S	1.178	0.33
60_F	69_H	1.165	0.32
33_H	39_A	1.158	0.32
28_V	44_F	1.154	0.32
25_V	68_F	1.116	0.30
35_A	78_V	1.102	0.30
13_H	49_G	1.084	0.29
64_A	73_R	1.039	0.27
31_S	77_D	1.036	0.27
29_S	85_W	1.021	0.27
17_A	66_F	1.008	0.26
12_E	23_S	0.987	0.25
76_L	83_V	0.981	0.25
38_K	56_F	0.976	0.25
37_S	65_Q	0.958	0.24
19_L	33_H	0.955	0.24
51_T	60_F	0.935	0.24
27_A	81_F	0.919	0.23
54_H	64_A	0.917	0.23
68_F	74_A	0.895	0.22
62_V	71_Q	0.888	0.22
73_R	84_D	0.866	0.21
20_A	48_R	0.866	0.21
41_V	82_R	0.862	0.21
31_S	65_Q	0.855	0.21
56_F	80_L	0.839	0.21
17_A	71_Q	0.829	0.20
32_V	76_L	0.824	0.20
20_A	49_G	0.796	0.19
26_A	42_E	0.780	0.19
43_S	66_F	0.778	0.19
9_D	48_R	0.774	0.19
38_K	62_V	0.770	0.18
21_A	52_V	0.752	0.18
7_A	47_D	0.744	0.18
12_E	60_F	0.741	0.18
12_E	46_G	0.736	0.18
25_V	59_E	0.721	0.17
72_D	80_L	0.718	0.17
41_V	50_G	0.715	0.17
38_K	64_A	0.689	0.16
75_V	81_F	0.685	0.16
73_R	76_L	0.683	0.16
54_H	67_S	0.681	0.16
34_N	76_L	0.677	0.16
50_G	77_D	0.677	0.16
67_S	73_R	0.660	0.16
61_A	70_T	0.660	0.16
19_L	45_A	0.643	0.15
22_A	78_V	0.640	0.15
39_A	78_V	0.633	0.15
14_A	55_A	0.633	0.15
12_E	72_D	0.631	0.15
12_E	45_A	0.627	0.15
22_A	63_P	0.625	0.15
7_A	46_G	0.618	0.14
59_E	75_V	0.618	0.14
38_K	81_F	0.616	0.14
43_S	84_D	0.603	0.14
24_E	71_Q	0.597	0.14
17_A	65_Q	0.595	0.14
45_A	83_V	0.595	0.14
35_A	58_A	0.589	0.14
48_R	60_F	0.587	0.14
44_F	66_F	0.587	0.14
26_A	34_N	0.579	0.14
32_V	79_E	0.576	0.14
12_E	63_P	0.574	0.13
61_A	73_R	0.572	0.13
34_N	60_F	0.572	0.13
48_R	63_P	0.563	0.13
25_V	57_A	0.561	0.13
19_L	79_E	0.549	0.13
56_F	67_S	0.547	0.13
35_A	76_L	0.547	0.13
39_A	54_H	0.545	0.13
27_A	65_Q	0.544	0.13
14_A	49_G	0.540	0.13
24_E	32_V	0.535	0.13
9_D	19_L	0.535	0.13
13_H	31_S	0.532	0.13
58_A	80_L	0.525	0.12
45_A	66_F	0.523	0.12
29_S	55_A	0.517	0.12
8_Q	24_E	0.514	0.12
69_H	78_V	0.513	0.12
25_V	72_D	0.511	0.12
7_A	79_E	0.509	0.12
13_H	74_A	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wy7A	1	0.9775	98.9	0.734	Contact Map
1ne2A	2	0.9551	98.3	0.78	Contact Map
3lkdA	1	0.8989	76.8	0.898	Contact Map
3khkA	1	0.8989	73.3	0.901	Contact Map
3tm4A	1	0.6404	71.8	0.902	Contact Map
3bzbA	1	0.7528	70.1	0.903	Contact Map
2ih2A	1	0.8764	62.7	0.908	Contact Map
3vseA	1	1	62.5	0.908	Contact Map
2ar0A	1	0.8989	60.4	0.91	Contact Map
2oyrA	1	0.6742	52.7	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.