Q9HR46 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR46 - Uncharacterized protein

UniProt:	Q9HR46	Sequences: METTRHFTATVYVVNDGATALHEHARLGLTIPPGGHVDRDELPHEAGLREVSEELGQEPTLLGDRPEIPAPAGVALPTPRYQLCYDINVHEDGSVGHQHIDHVYFGTVPTRTVAPDDGEAPPDAWEWYSPAALRADAAVDPDTARIGIEAIEAAAGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (127)
Sequences:	2360 (1701)
Seq/√Len:	151.0

ECOLI - NUDJ NUDG MUTT
BACSU - MUTT YJHB YVCI
HALSA - Q9HR46 Q9HS29
SULSO - Q97WE7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_N	18_A	5.817	1.00
52_S	58_E	4.432	1.00
37_V	46_A	4.143	1.00
33_P	55_L	3.513	1.00
60_T	107_T	3.457	1.00
11_V	47_G	3.393	1.00
51_V	59_P	2.957	1.00
11_V	106_G	2.939	1.00
11_V	51_V	2.918	1.00
13_V	51_V	2.688	1.00
23_E	124_A	2.564	1.00
42_L	45_E	2.297	1.00
18_A	129_S	1.938	1.00
129_S	132_A	1.870	1.00
23_E	28_G	1.745	1.00
62_L	107_T	1.713	1.00
10_T	32_P	1.673	1.00
48_L	52_S	1.574	1.00
17_G	130_P	1.559	1.00
22_H	33_P	1.521	1.00
57_Q	108_V	1.504	1.00
23_E	123_D	1.500	1.00
28_G	123_D	1.445	1.00
14_V	105_F	1.442	1.00
128_Y	134_R	1.438	1.00
31_I	34_G	1.367	1.00
61_L	106_G	1.363	1.00
21_L	128_Y	1.362	1.00
145_R	149_E	1.341	1.00
79_P	102_H	1.314	1.00
30_T	128_Y	1.304	1.00
132_A	135_A	1.292	1.00
10_T	103_V	1.242	1.00
10_T	101_D	1.232	1.00
37_V	43_P	1.220	1.00
126_E	132_A	1.192	1.00
9_A	46_A	1.172	1.00
48_L	59_P	1.162	1.00
90_H	94_S	1.158	1.00
58_E	110_T	1.148	1.00
128_Y	137_A	1.145	1.00
40_D	45_E	1.128	1.00
24_H	31_I	1.123	0.99
22_H	125_W	1.079	0.99
83_L	87_I	1.076	0.99
7_F	37_V	1.064	0.99
44_H	61_L	1.063	0.99
81_Y	85_Y	1.039	0.99
81_Y	103_V	1.039	0.99
37_V	100_I	1.033	0.99
84_C	87_I	1.003	0.99
24_H	27_L	0.993	0.99
108_V	127_W	0.988	0.99
8_T	36_H	0.987	0.99
36_H	99_H	0.979	0.99
110_T	113_V	0.977	0.99
24_H	36_H	0.969	0.98
79_P	82_Q	0.965	0.98
84_C	89_V	0.961	0.98
116_D	122_P	0.959	0.98
82_Q	85_Y	0.956	0.98
85_Y	88_N	0.948	0.98
115_P	118_G	0.940	0.98
83_L	86_D	0.932	0.98
62_L	105_F	0.928	0.98
22_H	122_P	0.907	0.98
134_R	137_A	0.897	0.98
25_A	123_D	0.893	0.97
15_N	112_T	0.878	0.97
34_G	38_D	0.875	0.97
16_D	107_T	0.869	0.97
39_R	43_P	0.866	0.97
117_D	122_P	0.860	0.97
139_V	143_T	0.859	0.97
60_T	63_G	0.858	0.97
82_Q	90_H	0.858	0.97
32_P	103_V	0.848	0.97
41_E	49_R	0.848	0.97
33_P	125_W	0.847	0.96
82_Q	89_V	0.838	0.96
19_T	133_L	0.831	0.96
81_Y	84_C	0.826	0.96
29_L	138_A	0.826	0.96
57_Q	113_V	0.822	0.96
86_D	89_V	0.816	0.96
31_I	142_D	0.814	0.96
47_G	51_V	0.805	0.95
95_V	98_Q	0.805	0.95
145_R	148_I	0.802	0.95
135_A	138_A	0.797	0.95
130_P	151_I	0.791	0.95
12_Y	32_P	0.791	0.95
131_A	135_A	0.788	0.95
50_E	53_E	0.780	0.94
96_G	99_H	0.777	0.94
82_Q	87_I	0.776	0.94
88_N	94_S	0.766	0.94
14_V	130_P	0.761	0.94
134_R	148_I	0.760	0.94
109_P	112_T	0.760	0.94
50_E	54_E	0.753	0.93
46_A	49_R	0.748	0.93
94_S	97_H	0.748	0.93
144_A	148_I	0.744	0.93
85_Y	90_H	0.740	0.93
36_H	101_D	0.722	0.92
10_T	121_P	0.721	0.92
45_E	48_L	0.711	0.91
87_I	97_H	0.708	0.91
47_G	61_L	0.707	0.91
81_Y	87_I	0.700	0.91
86_D	98_Q	0.691	0.90
147_G	150_A	0.687	0.90
7_F	102_H	0.684	0.90
59_P	106_G	0.683	0.90
10_T	36_H	0.680	0.89
90_H	95_V	0.680	0.89
33_P	51_V	0.678	0.89
48_L	61_L	0.676	0.89
60_T	109_P	0.676	0.89
10_T	143_T	0.674	0.89
81_Y	86_D	0.671	0.89
19_T	151_I	0.662	0.88
47_G	106_G	0.661	0.88
51_V	106_G	0.659	0.88
43_P	46_A	0.657	0.88
13_V	108_V	0.647	0.87
26_R	122_P	0.639	0.86
14_V	56_G	0.638	0.86
25_A	121_P	0.637	0.86
103_V	146_I	0.634	0.86
111_R	116_D	0.628	0.85
139_V	144_A	0.627	0.85
10_T	146_I	0.625	0.85
44_H	48_L	0.624	0.85
140_D	143_T	0.623	0.85
8_T	101_D	0.619	0.84
144_A	147_G	0.617	0.84
84_C	88_N	0.616	0.84
122_P	125_W	0.614	0.84
58_E	61_L	0.610	0.84
12_Y	146_I	0.608	0.83
107_T	110_T	0.606	0.83
80_R	149_E	0.604	0.83
64_D	135_A	0.604	0.83
48_L	106_G	0.602	0.83
27_L	97_H	0.601	0.83
29_L	140_D	0.601	0.83
45_E	49_R	0.600	0.83
13_V	106_G	0.600	0.83
19_T	147_G	0.596	0.82
81_Y	100_I	0.593	0.82
141_P	144_A	0.591	0.82
11_V	33_P	0.591	0.82
111_R	114_A	0.589	0.81
15_N	110_T	0.585	0.81
113_V	116_D	0.582	0.81
17_G	131_A	0.582	0.81
24_H	121_P	0.581	0.80
32_P	101_D	0.573	0.80
18_A	111_R	0.572	0.79
30_T	126_E	0.572	0.79
9_A	32_P	0.567	0.79
63_G	105_F	0.559	0.78
35_G	50_E	0.557	0.78
87_I	90_H	0.556	0.78
11_V	61_L	0.555	0.77
66_P	149_E	0.552	0.77
12_Y	150_A	0.552	0.77
24_H	122_P	0.549	0.77
83_L	88_N	0.549	0.77
19_T	150_A	0.547	0.76
12_Y	151_I	0.547	0.76
44_H	63_G	0.541	0.76
59_P	63_G	0.541	0.76
89_V	95_V	0.537	0.75
36_H	121_P	0.537	0.75
142_D	145_R	0.534	0.75
24_H	99_H	0.533	0.75
52_S	111_R	0.532	0.74
126_E	137_A	0.528	0.74
84_C	98_Q	0.527	0.74
23_E	29_L	0.522	0.73
13_V	57_Q	0.521	0.73
43_P	104_Y	0.511	0.71
21_L	25_A	0.507	0.71
36_H	97_H	0.505	0.71
111_R	123_D	0.503	0.70
85_Y	89_V	0.501	0.70
82_Q	88_N	0.500	0.70

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3f6aA	2	0.9236	99.9	0.392	Contact Map
1k2eA	2	0.8854	99.9	0.407	Contact Map
3fcmA	2	0.8917	99.9	0.415	Contact Map
2qjtB	2	0.8854	99.9	0.417	Contact Map
2qjoA	3	0.8854	99.9	0.426	Contact Map
3i7uA	4	0.8408	99.9	0.429	Contact Map
4mpoA	4	0.8662	99.9	0.431	Contact Map
2azwA	1	0.8471	99.9	0.433	Contact Map
4dywA	2	0.7898	99.9	0.443	Contact Map
3i9xA	2	0.8599	99.9	0.443	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.