GATC - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GATC - Glutamyl-tRNA(Gln) amidotransferase subunit C

UniProt:	Q9HR44	Sequences: MTDAVDAEEIRHVADLARLRLDDEDVDTVVDHCGDILEHFERLEEVPEVDAEPELVNVMRADEIADSLDQDDALANAPETEDGRFKGPNVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	91 (87)
Sequences:	2219 (1391)
Seq/√Len:	149.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_R	26_V	3.789	1.00
6_D	9_E	2.905	1.00
68_L	73_A	2.898	1.00
69_D	72_D	2.886	1.00
7_A	27_D	2.707	1.00
79_E	86_K	2.618	1.00
22_D	25_D	2.533	1.00
70_Q	83_G	2.283	1.00
8_E	11_R	2.052	1.00
7_A	26_V	1.923	1.00
69_D	73_A	1.896	1.00
34_G	38_E	1.840	1.00
29_V	32_H	1.819	1.00
7_A	11_R	1.751	1.00
73_A	85_F	1.751	1.00
80_T	83_G	1.698	1.00
74_L	80_T	1.694	1.00
47_P	50_D	1.658	1.00
72_D	75_A	1.623	1.00
28_T	32_H	1.616	1.00
32_H	35_D	1.544	1.00
27_D	30_V	1.534	1.00
34_G	37_L	1.433	1.00
21_L	26_V	1.359	1.00
66_D	69_D	1.351	1.00
41_E	44_E	1.298	1.00
21_L	29_V	1.267	1.00
13_V	17_A	1.237	1.00
39_H	43_L	1.233	1.00
11_R	23_D	1.223	1.00
7_A	23_D	1.209	1.00
42_R	45_E	1.188	1.00
4_A	34_G	1.154	1.00
23_D	26_V	1.141	1.00
64_I	67_S	1.140	1.00
70_Q	73_A	1.138	1.00
58_V	86_K	1.109	0.99
27_D	31_D	1.089	0.99
76_N	85_F	1.088	0.99
38_E	41_E	1.086	0.99
80_T	84_R	1.078	0.99
10_I	30_V	1.059	0.99
10_I	33_C	1.044	0.99
30_V	34_G	1.012	0.99
13_V	32_H	0.989	0.99
43_L	48_E	0.970	0.98
31_D	35_D	0.956	0.98
35_D	39_H	0.931	0.98
10_I	14_A	0.909	0.98
15_D	18_R	0.886	0.97
35_D	38_E	0.883	0.97
4_A	41_E	0.878	0.97
48_E	51_A	0.824	0.96
22_D	26_V	0.814	0.95
21_L	42_R	0.808	0.95
39_H	42_R	0.802	0.95
43_L	47_P	0.799	0.95
74_L	85_F	0.795	0.95
9_E	14_A	0.790	0.95
29_V	33_C	0.788	0.95
81_E	86_K	0.788	0.95
70_Q	74_L	0.779	0.94
57_N	86_K	0.769	0.94
25_D	28_T	0.767	0.94
5_V	30_V	0.758	0.93
37_L	89_N	0.755	0.93
10_I	26_V	0.752	0.93
74_L	77_A	0.752	0.93
19_L	29_V	0.739	0.92
77_A	85_F	0.738	0.92
9_E	13_V	0.737	0.92
32_H	36_I	0.727	0.92
40_F	84_R	0.724	0.92
7_A	30_V	0.722	0.92
28_T	31_D	0.706	0.91
6_D	41_E	0.704	0.91
24_E	27_D	0.691	0.90
4_A	37_L	0.684	0.89
19_L	36_I	0.679	0.89
30_V	40_F	0.673	0.89
18_R	87_G	0.672	0.88
26_V	30_V	0.664	0.88
43_L	84_R	0.658	0.87
33_C	87_G	0.641	0.86
10_I	13_V	0.641	0.86
24_E	28_T	0.638	0.86
13_V	82_D	0.633	0.85
43_L	46_V	0.632	0.85
13_V	34_G	0.629	0.85
4_A	90_V	0.622	0.84
9_E	12_H	0.621	0.84
57_N	68_L	0.616	0.84
59_M	84_R	0.613	0.83
54_E	88_P	0.610	0.83
78_P	87_G	0.608	0.83
19_L	86_K	0.603	0.82
76_N	80_T	0.600	0.82
14_A	78_P	0.600	0.82
54_E	85_F	0.589	0.81
49_V	52_E	0.588	0.81
15_D	20_R	0.588	0.81
68_L	72_D	0.569	0.79
14_A	60_R	0.568	0.79
22_D	27_D	0.568	0.79
67_S	73_A	0.565	0.78
28_T	35_D	0.558	0.77
14_A	87_G	0.555	0.77
8_E	23_D	0.552	0.77
39_H	55_L	0.551	0.76
35_D	41_E	0.549	0.76
17_A	30_V	0.549	0.76
65_A	68_L	0.549	0.76
41_E	90_V	0.544	0.76
9_E	37_L	0.540	0.75
5_V	15_D	0.539	0.75
34_G	88_P	0.536	0.74
46_V	87_G	0.534	0.74
40_F	87_G	0.527	0.73
21_L	25_D	0.527	0.73
7_A	28_T	0.524	0.73
19_L	87_G	0.523	0.73
9_E	30_V	0.521	0.72
27_D	52_E	0.519	0.72
33_C	51_A	0.516	0.72
55_L	58_V	0.511	0.71
22_D	60_R	0.508	0.71
37_L	59_M	0.506	0.70
13_V	76_N	0.503	0.70
12_H	16_L	0.502	0.70
27_D	50_D	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3al0C	1	0.956	100	0.161	Contact Map
3kfuG	1	0.9451	100	0.17	Contact Map
3ip4C	1	0.956	100	0.197	Contact Map
3h0lC	1	0.9451	100	0.199	Contact Map
4wj3C	1	0.967	100	0.205	Contact Map
4n0hF	1	0.8791	99.9	0.273	Contact Map
1pzgA	4	0.5055	35.3	0.9	Contact Map
4cl3A	4	0.4725	19.9	0.911	Contact Map
1y6jA	2	0.4615	19.2	0.912	Contact Map
3d0oA	4	0.4396	18.5	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.