Q9HR40 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR40 - Uncharacterized protein

UniProt:	Q9HR40	Sequences: MLGLAVAGGLAGFLFAAPGAVHHRGYITPRENGLIALAGPLMNVVLGAVSLVVLVTVAPRVGYWGVFINVLLAGFNMIPFGPLDGATVLEWSTTAYALSAVVTIGPAVLFFAGVLV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (109)
Sequences:	177 (145)
Seq/√Len:	13.8

HALSA - Q9HR40
SULSO - Q97ZW1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_G	91_W	3.760	0.99
77_M	96_Y	3.692	0.99
37_L	99_S	3.614	0.99
30_R	34_L	3.538	0.99
46_L	65_G	2.636	0.94
81_G	86_A	2.556	0.93
50_S	65_G	2.286	0.88
21_V	72_L	2.178	0.86
47_G	70_V	2.167	0.85
17_A	21_V	2.075	0.83
12_G	16_A	1.986	0.80
46_L	50_S	1.963	0.79
32_N	89_L	1.863	0.75
4_L	27_I	1.758	0.70
36_A	70_V	1.743	0.70
22_H	32_N	1.706	0.68
77_M	90_E	1.667	0.66
23_H	36_A	1.667	0.66
41_L	44_V	1.648	0.65
35_I	72_L	1.627	0.64
73_A	92_S	1.492	0.57
25_G	28_T	1.460	0.56
17_A	20_A	1.424	0.54
32_N	36_A	1.421	0.54
22_H	42_M	1.394	0.52
25_G	80_F	1.358	0.50
20_A	72_L	1.348	0.50
46_L	95_A	1.316	0.48
5_A	18_P	1.305	0.47
77_M	103_T	1.296	0.47
2_L	68_I	1.282	0.46
83_L	108_V	1.258	0.45
14_L	70_V	1.248	0.44
100_A	104_I	1.241	0.44
23_H	87_T	1.216	0.43
27_I	32_N	1.213	0.42
31_E	73_A	1.212	0.42
49_V	64_W	1.147	0.39
31_E	46_L	1.131	0.38
53_V	61_V	1.131	0.38
105_G	109_L	1.107	0.37
37_L	95_A	1.100	0.37
16_A	20_A	1.092	0.36
55_V	105_G	1.073	0.35
46_L	62_G	1.065	0.35
14_L	83_L	1.059	0.35
53_V	60_R	1.059	0.35
77_M	99_S	1.054	0.34
52_V	92_S	1.043	0.34
25_G	81_G	1.042	0.34
71_L	77_M	1.030	0.33
7_A	45_V	1.021	0.33
11_A	34_L	1.011	0.32
4_L	28_T	0.997	0.32
15_F	68_I	0.989	0.31
3_G	70_V	0.970	0.30
13_F	18_P	0.969	0.30
22_H	71_L	0.963	0.30
51_L	55_V	0.953	0.30
15_F	69_N	0.948	0.29
58_A	78_I	0.940	0.29
56_T	61_V	0.937	0.29
49_V	78_I	0.931	0.29
51_L	104_I	0.930	0.29
57_V	80_F	0.908	0.28
36_A	88_V	0.907	0.28
32_N	87_T	0.896	0.27
28_T	62_G	0.896	0.27
5_A	65_G	0.882	0.26
71_L	74_G	0.880	0.26
82_P	97_A	0.879	0.26
10_L	64_W	0.871	0.26
74_G	78_I	0.851	0.25
21_V	82_P	0.850	0.25
53_V	100_A	0.848	0.25
6_V	57_V	0.845	0.25
26_Y	108_V	0.837	0.25
7_A	52_V	0.836	0.25
10_L	36_A	0.835	0.25
3_G	8_G	0.833	0.24
44_V	77_M	0.830	0.24
36_A	87_T	0.830	0.24
21_V	35_I	0.824	0.24
42_M	96_Y	0.800	0.23
38_A	52_V	0.795	0.23
17_A	35_I	0.791	0.23
53_V	64_W	0.790	0.23
8_G	14_L	0.787	0.23
68_I	72_L	0.785	0.23
14_L	35_I	0.782	0.22
15_F	20_A	0.779	0.22
74_G	96_Y	0.777	0.22
5_A	35_I	0.765	0.22
25_G	33_G	0.754	0.21
55_V	86_A	0.750	0.21
12_G	17_A	0.740	0.21
36_A	73_A	0.735	0.21
3_G	87_T	0.732	0.21
51_L	99_S	0.729	0.21
5_A	17_A	0.727	0.20
62_G	107_A	0.724	0.20
78_I	86_A	0.722	0.20
36_A	72_L	0.716	0.20
25_G	91_W	0.711	0.20
18_P	46_L	0.702	0.20
70_V	110_F	0.695	0.19
41_L	47_G	0.691	0.19
53_V	97_A	0.687	0.19
21_V	25_G	0.667	0.18
86_A	106_P	0.667	0.18
53_V	102_V	0.666	0.18
49_V	53_V	0.665	0.18
2_L	16_A	0.659	0.18
26_Y	42_M	0.657	0.18
41_L	108_V	0.656	0.18
50_S	95_A	0.656	0.18
74_G	101_V	0.654	0.18
38_A	98_L	0.644	0.18
67_F	96_Y	0.638	0.18
8_G	81_G	0.634	0.17
86_A	93_T	0.630	0.17
63_Y	105_G	0.628	0.17
6_V	103_T	0.628	0.17
13_F	83_L	0.627	0.17
80_F	83_L	0.627	0.17
37_L	104_I	0.625	0.17
70_V	102_V	0.625	0.17
61_V	94_T	0.618	0.17
62_G	65_G	0.616	0.17
7_A	104_I	0.607	0.17
9_G	96_Y	0.603	0.16
70_V	101_V	0.600	0.16
95_A	104_I	0.596	0.16
21_V	27_I	0.596	0.16
36_A	45_V	0.591	0.16
47_G	72_L	0.588	0.16
89_L	95_A	0.572	0.16
10_L	54_L	0.570	0.15
14_L	48_A	0.566	0.15
53_V	57_V	0.563	0.15
10_L	16_A	0.559	0.15
88_V	91_W	0.558	0.15
90_E	93_T	0.557	0.15
8_G	36_A	0.556	0.15
12_G	20_A	0.556	0.15
44_V	99_S	0.546	0.15
41_L	45_V	0.544	0.15
96_Y	100_A	0.543	0.15
63_Y	67_F	0.542	0.15
42_M	56_T	0.540	0.15
95_A	107_A	0.539	0.15
10_L	68_I	0.536	0.15
7_A	11_A	0.529	0.14
17_A	73_A	0.529	0.14
12_G	50_S	0.526	0.14
15_F	94_T	0.525	0.14
82_P	110_F	0.517	0.14
63_Y	107_A	0.517	0.14
6_V	53_V	0.511	0.14
90_E	96_Y	0.509	0.14
26_Y	94_T	0.508	0.14
41_L	67_F	0.505	0.14
28_T	77_M	0.502	0.14
53_V	109_L	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b4rA	2	0.8621	99.2	0.685	Contact Map
3x29A	1	0.8103	4.6	0.948	Contact Map
4p79A	1	0.8448	3.4	0.951	Contact Map
4l6vi	1	0.2672	2.1	0.956	Contact Map
1scfA	4	0	1.9	0.957	Contact Map
1ciiA	1	0.4224	1.6	0.959	Contact Map
4i0uA	4	0.4138	1.3	0.961	Contact Map
4ltoA	3	0.7155	1	0.963	Contact Map
2pjvA	1	0.2069	1	0.963	Contact Map
4gd3A	2	0.2759	1	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.