Q9HR38 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR38 - Inosine-5'-monophosphate dehydrogenase-like

UniProt:	Q9HR38	Sequences: MHADLVSVAPDDAVSDAVARMQNAGYSQLPVISSGVPVGSISDNDIVHAGEDVGDHAVREVMSESFPTVSADATLDEISSLLDHYKAVMVTEDGETVGIITQADIAARIS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	110 (104)
Sequences:	11485 (8628)
Seq/√Len:	846.0

ECOLI - IMDH KDSD GUTQ YFJD CORC
BACSU - ACUB CCPN YKUL YLBB YHCV IMDH YTOI MGTE YUGS YRKA YHDP
HALSA - Q9HR38 Q9HQD0 Q9HPF4 Q9HRK9 Q9HNT8 Q9HMW8 Q9HNB6 IMDH Q9HPN8 Q9HRX1 Q9HHN9 Q9HN02
SULSO - Q981B7 Q97U20 Q7LXY4 Q97V95 Q97U00 Q7LXN6 Q97VN1 Q97VD7 Q97U50 Q97Z58 Q97U23

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_D	16_D	2.961	1.00
8_V	12_D	2.475	1.00
10_P	38_V	2.302	1.00
73_A	77_E	2.233	1.00
8_V	31_V	2.177	1.00
10_P	33_S	2.155	1.00
69_V	73_A	2.142	1.00
28_Q	87_A	2.067	1.00
9_A	12_D	1.978	1.00
6_V	24_A	1.973	1.00
67_P	85_Y	1.915	1.00
30_P	37_P	1.883	1.00
70_S	73_A	1.851	1.00
69_V	90_V	1.811	1.00
71_A	97_V	1.802	1.00
8_V	29_L	1.798	1.00
71_A	92_E	1.791	1.00
33_S	36_V	1.766	1.00
8_V	17_A	1.725	1.00
17_A	29_L	1.658	1.00
10_P	59_R	1.650	1.00
17_A	41_I	1.628	1.00
17_A	58_V	1.581	1.00
20_R	24_A	1.546	1.00
56_H	60_E	1.534	1.00
33_S	38_V	1.526	1.00
13_A	16_D	1.526	1.00
43_D	47_V	1.497	1.00
28_Q	40_S	1.472	1.00
57_A	60_E	1.467	1.00
81_L	85_Y	1.339	1.00
19_A	23_N	1.336	1.00
41_I	46_I	1.305	1.00
89_M	96_T	1.279	1.00
15_S	19_A	1.257	1.00
77_E	81_L	1.246	1.00
97_V	101_T	1.245	1.00
69_V	78_I	1.223	1.00
7_S	32_I	1.212	1.00
80_S	84_H	1.210	1.00
27_S	43_D	1.186	1.00
92_E	95_E	1.180	1.00
41_I	58_V	1.165	1.00
37_P	66_F	1.125	1.00
70_S	92_E	1.125	1.00
6_V	20_R	1.125	1.00
6_V	26_Y	1.113	1.00
54_G	57_A	1.089	1.00
12_D	20_R	1.085	1.00
30_P	96_T	1.070	1.00
18_V	46_I	1.069	1.00
68_T	91_T	1.063	1.00
21_M	29_L	1.054	1.00
74_T	77_E	1.054	1.00
67_P	81_L	1.053	1.00
16_D	19_A	1.039	1.00
8_V	58_V	1.023	1.00
9_A	33_S	1.014	1.00
52_D	55_D	1.008	1.00
11_D	59_R	1.002	1.00
78_I	88_V	0.990	1.00
53_V	56_H	0.986	1.00
41_I	61_V	0.962	1.00
35_G	95_E	0.955	1.00
27_S	44_N	0.916	1.00
15_S	54_G	0.914	1.00
32_I	38_V	0.911	1.00
75_L	105_I	0.905	1.00
20_R	23_N	0.889	1.00
15_S	55_D	0.889	1.00
45_D	63_S	0.886	1.00
78_I	100_I	0.873	1.00
26_Y	29_L	0.870	1.00
8_V	20_R	0.862	1.00
58_V	62_M	0.858	1.00
51_E	54_G	0.852	1.00
78_I	82_L	0.836	1.00
56_H	61_V	0.827	1.00
73_A	81_L	0.821	1.00
27_S	102_Q	0.811	1.00
51_E	56_H	0.806	1.00
56_H	64_E	0.804	1.00
50_G	53_V	0.798	1.00
87_A	102_Q	0.763	1.00
87_A	101_T	0.756	1.00
87_A	99_I	0.754	1.00
57_A	61_V	0.750	1.00
91_T	96_T	0.746	1.00
14_V	61_V	0.745	1.00
76_D	80_S	0.742	1.00
77_E	80_S	0.735	1.00
14_V	18_V	0.733	1.00
43_D	103_A	0.731	1.00
37_P	96_T	0.725	1.00
49_A	53_V	0.721	1.00
18_V	43_D	0.718	1.00
82_L	86_K	0.715	1.00
20_R	29_L	0.713	1.00
69_V	88_V	0.708	1.00
101_T	104_D	0.704	1.00
32_I	35_G	0.703	1.00
28_Q	42_S	0.697	1.00
18_V	47_V	0.691	1.00
28_Q	99_I	0.689	1.00
92_E	97_V	0.683	1.00
40_S	87_A	0.678	1.00
75_L	79_S	0.676	1.00
39_G	62_M	0.674	1.00
14_V	46_I	0.672	1.00
40_S	89_M	0.668	1.00
27_S	87_A	0.665	1.00
83_D	86_K	0.664	1.00
52_D	56_H	0.662	1.00
75_L	100_I	0.659	1.00
31_V	62_M	0.657	1.00
36_V	94_G	0.657	1.00
9_A	32_I	0.656	1.00
16_D	20_R	0.656	1.00
37_P	89_M	0.649	1.00
17_A	21_M	0.648	1.00
49_A	61_V	0.642	1.00
79_S	87_A	0.636	1.00
27_S	103_A	0.628	1.00
69_V	81_L	0.597	1.00
44_N	48_H	0.575	1.00
58_V	63_S	0.574	1.00
5_L	30_P	0.572	1.00
77_E	84_H	0.569	1.00
75_L	78_I	0.569	1.00
96_T	99_I	0.566	1.00
22_Q	48_H	0.563	1.00
103_A	106_A	0.558	1.00
28_Q	102_Q	0.557	1.00
22_Q	43_D	0.556	1.00
79_S	105_I	0.556	1.00
9_A	35_G	0.556	1.00
81_L	88_V	0.555	1.00
7_S	29_L	0.553	1.00
68_T	94_G	0.552	1.00
102_Q	106_A	0.546	1.00
43_D	49_A	0.543	1.00
32_I	37_P	0.532	1.00
49_A	56_H	0.527	1.00
12_D	29_L	0.522	1.00
26_Y	30_P	0.520	1.00
27_S	30_P	0.519	1.00
74_T	78_I	0.518	1.00
20_R	30_P	0.515	1.00
31_V	38_V	0.513	1.00
79_S	106_A	0.512	1.00
62_M	66_F	0.510	1.00
88_V	91_T	0.509	1.00
70_S	94_G	0.508	1.00
30_P	89_M	0.505	1.00
27_S	42_S	0.500	1.00
36_V	95_E	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pc3A	2	1	99.8	0.214	Contact Map
4cooA	2	1	99.8	0.215	Contact Map
3l2bA	2	0.9364	99.8	0.215	Contact Map
3k6eA	2	1	99.7	0.253	Contact Map
1vr9A	1	0.9727	99.7	0.255	Contact Map
2o16A	2	1	99.7	0.256	Contact Map
2qrdG	1	1	99.7	0.26	Contact Map
4uuuA	2	1	99.7	0.26	Contact Map
3orgA	2	0.9545	99.7	0.264	Contact Map
2zy9A	2	0.9727	99.7	0.268	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.