Y879 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y879 - UPF0212 protein VNG_0879C

UniProt:	Q9HR37	Sequences: MSNYVVAMEAAWLVRDVENSDDAIGVAVSEAGKRLNDQDLDYVEVEAGVTGCPACGEGLDAAFLAANTALVGLVLELTVFNADSDEHAQRIAKSEVGGALRDVPLEVIDVIEDGDAPAEEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	121 (112)
Sequences:	105 (36)
Seq/√Len:	3.4

HALSA - Y879 Y1264

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_A	14_V	3.448	0.65
10_A	75_L	3.169	0.58
12_W	30_E	2.697	0.45
82_A	91_I	2.611	0.43
41_D	79_V	2.439	0.39
9_E	16_D	2.433	0.38
9_E	21_D	2.045	0.29
42_Y	78_T	1.968	0.28
34_R	73_L	1.965	0.28
31_A	34_R	1.948	0.27
38_Q	77_L	1.872	0.26
44_E	59_L	1.817	0.25
25_G	94_S	1.790	0.24
39_D	63_F	1.739	0.23
31_A	73_L	1.704	0.22
3_N	57_E	1.696	0.22
24_I	99_A	1.694	0.22
52_C	55_C	1.678	0.22
20_S	46_E	1.657	0.22
40_L	79_V	1.656	0.22
30_E	34_R	1.655	0.21
12_W	31_A	1.648	0.21
77_L	96_V	1.618	0.21
10_A	101_R	1.540	0.19
13_L	65_A	1.521	0.19
26_V	77_L	1.498	0.19
39_D	95_E	1.491	0.19
44_E	76_E	1.482	0.19
79_V	96_V	1.445	0.18
26_V	45_V	1.442	0.18
54_A	65_A	1.382	0.17
10_A	59_L	1.370	0.17
26_V	40_L	1.367	0.17
25_G	29_S	1.292	0.16
29_S	94_S	1.270	0.15
46_E	108_I	1.247	0.15
7_A	81_N	1.233	0.15
19_N	63_F	1.232	0.15
18_E	73_L	1.225	0.15
9_E	46_E	1.223	0.15
64_L	109_D	1.221	0.15
22_D	33_K	1.218	0.15
16_D	21_D	1.214	0.15
68_T	103_V	1.205	0.15
61_A	109_D	1.169	0.14
9_E	106_E	1.169	0.14
38_Q	79_V	1.168	0.14
12_W	34_R	1.164	0.14
8_M	80_F	1.147	0.14
26_V	38_Q	1.133	0.14
99_A	103_V	1.127	0.14
44_E	101_R	1.118	0.13
57_E	60_D	1.109	0.13
40_L	81_N	1.088	0.13
73_L	101_R	1.084	0.13
25_G	98_G	1.061	0.13
42_Y	81_N	1.055	0.13
34_R	44_E	1.054	0.13
90_R	100_L	1.030	0.12
14_V	47_A	1.009	0.12
45_V	77_L	1.008	0.12
67_N	96_V	1.001	0.12
12_W	22_D	0.984	0.12
64_L	67_N	0.980	0.12
57_E	66_A	0.976	0.12
73_L	95_E	0.967	0.12
28_V	83_D	0.954	0.12
78_T	98_G	0.953	0.11
8_M	98_G	0.931	0.11
16_D	29_S	0.927	0.11
50_T	58_G	0.922	0.11
49_V	83_D	0.910	0.11
58_G	81_N	0.906	0.11
22_D	30_E	0.897	0.11
75_L	101_R	0.888	0.11
64_L	75_L	0.877	0.11
68_T	72_G	0.869	0.11
62_A	74_V	0.855	0.10
103_V	106_E	0.849	0.10
3_N	7_A	0.846	0.10
18_E	39_D	0.843	0.10
71_V	86_E	0.842	0.10
38_Q	78_T	0.839	0.10
16_D	46_E	0.820	0.10
48_G	104_P	0.814	0.10
19_N	38_Q	0.809	0.10
40_L	77_L	0.806	0.10
84_S	114_G	0.805	0.10
67_N	95_E	0.794	0.10
40_L	110_V	0.791	0.10
17_V	103_V	0.786	0.10
36_N	84_S	0.778	0.10
90_R	104_P	0.756	0.10
15_R	72_G	0.753	0.10
4_Y	72_G	0.753	0.10
96_V	111_I	0.749	0.09
15_R	26_V	0.744	0.09
17_V	24_I	0.741	0.09
52_C	93_K	0.734	0.09
3_N	79_V	0.732	0.09
77_L	85_D	0.728	0.09
62_A	70_L	0.726	0.09
44_E	73_L	0.721	0.09
29_S	46_E	0.720	0.09
11_A	21_D	0.720	0.09
26_V	41_D	0.717	0.09
14_V	56_G	0.713	0.09
74_V	103_V	0.709	0.09
21_D	85_D	0.707	0.09
21_D	49_V	0.707	0.09
50_T	54_A	0.690	0.09
32_G	69_A	0.689	0.09
28_V	62_A	0.687	0.09
11_A	66_A	0.684	0.09
99_A	102_D	0.683	0.09
3_N	26_V	0.678	0.09
29_S	60_D	0.675	0.09
19_N	67_N	0.673	0.09
18_E	75_L	0.672	0.09
13_L	94_S	0.667	0.09
26_V	60_D	0.661	0.09
8_M	35_L	0.645	0.09
25_G	83_D	0.641	0.09
16_D	94_S	0.632	0.08
20_S	96_V	0.629	0.08
31_A	101_R	0.626	0.08
62_A	73_L	0.626	0.08
14_V	40_L	0.622	0.08
81_N	107_V	0.620	0.08
50_T	60_D	0.614	0.08
20_S	47_A	0.610	0.08
9_E	103_V	0.609	0.08
28_V	95_E	0.606	0.08
40_L	58_G	0.600	0.08
85_D	90_R	0.598	0.08
34_R	45_V	0.596	0.08
36_N	42_Y	0.588	0.08
31_A	44_E	0.576	0.08
75_L	102_D	0.573	0.08
46_E	91_I	0.573	0.08
4_Y	82_A	0.569	0.08
21_D	90_R	0.564	0.08
15_R	45_V	0.558	0.08
4_Y	77_L	0.555	0.08
3_N	60_D	0.554	0.08
59_L	76_E	0.552	0.08
44_E	62_A	0.550	0.08
35_L	53_P	0.546	0.08
13_L	54_A	0.543	0.08
52_C	72_G	0.543	0.08
69_A	110_V	0.540	0.08
10_A	18_E	0.539	0.08
7_A	95_E	0.531	0.08
89_Q	109_D	0.531	0.08
9_E	14_V	0.529	0.08
18_E	44_E	0.525	0.08
94_S	98_G	0.522	0.08
26_V	58_G	0.516	0.08
62_A	75_L	0.516	0.08
42_Y	83_D	0.513	0.08
72_G	93_K	0.513	0.08
3_N	113_D	0.512	0.08
34_R	101_R	0.509	0.07
78_T	91_I	0.506	0.07
47_A	66_A	0.505	0.07
20_S	62_A	0.505	0.07
13_L	45_V	0.501	0.07
22_D	52_C	0.500	0.07

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vxaA	5	0.5207	43.5	0.939	Contact Map
3vpbE	1	0.4298	18.7	0.949	Contact Map
4mwaA	4	0.3058	15.7	0.951	Contact Map
2i5oA	1	0.2397	14.4	0.952	Contact Map
2ux9A	5	0.5455	14.1	0.952	Contact Map
4u3eA	2	0.7438	10.3	0.955	Contact Map
3ga8A	1	0.4628	9.5	0.956	Contact Map
1tfeA	2	0.3884	7.4	0.958	Contact Map
4g38A	1	0.9174	7	0.958	Contact Map
2lcqA	1	0.5455	6.7	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.