Q9HR34 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR34 - p-nitrophenyl phosphatase

UniProt:	Q9HR34	Sequences: MRPASEHAARLEGLGVDATPGEVLTATDATITYLQRSHDGAAVYPIAADAITTQLRAAGVAITADPVAADVVVAGFDPAFGFQDLQAAVDAFADGTTALVGTDPDITIPAADGAKPGSGAIVQAVAGVAERDPDAVLGKPSETTARLAVDRLGVPPAECLVVGDRPDTDVALGAAAGMTTALVRTGVDAATPAHAQPDHVLDSLGEIGRLIA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	212 (202)
Sequences:	3724 (2590)
Seq/√Len:	182.2

ECOLI - NAGD
BACSU - YUTF ARAL
HALSA - Q9HR34 Q9HRF8
SULSO - Q97W80

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
173_G	180_T	5.057	1.00
160_L	181_A	3.541	1.00
101_G	122_V	3.237	1.00
171_A	175_A	3.048	1.00
179_T	198_D	2.938	1.00
142_E	146_R	2.854	1.00
126_A	132_D	2.807	1.00
42_A	61_A	2.638	1.00
154_V	159_C	2.545	1.00
126_A	133_P	2.442	1.00
5_S	20_P	2.408	1.00
203_S	206_E	2.262	1.00
170_V	180_T	2.163	1.00
45_P	55_L	1.947	1.00
149_V	159_C	1.918	1.00
202_D	206_E	1.913	1.00
106_I	127_G	1.846	1.00
161_V	178_M	1.836	1.00
30_T	73_V	1.815	1.00
77_D	84_D	1.805	1.00
181_A	201_L	1.790	1.00
123_Q	127_G	1.766	1.00
184_R	200_V	1.758	1.00
123_Q	126_A	1.744	1.00
81_G	84_D	1.714	1.00
145_A	172_L	1.702	1.00
92_F	125_V	1.693	1.00
30_T	100_V	1.690	1.00
155_P	158_E	1.632	1.00
9_A	13_G	1.627	1.00
48_A	78_P	1.626	1.00
99_L	133_P	1.612	1.00
49_D	53_T	1.602	1.00
174_A	198_D	1.565	1.00
31_I	58_A	1.552	1.00
37_S	98_A	1.543	1.00
8_A	20_P	1.528	1.00
42_A	70_D	1.527	1.00
146_R	156_P	1.503	1.00
108_I	117_G	1.485	1.00
8_A	12_E	1.476	1.00
29_A	144_T	1.468	1.00
100_V	137_L	1.462	1.00
41_A	70_D	1.461	1.00
145_A	161_V	1.458	1.00
5_S	9_A	1.438	1.00
90_D	112_D	1.421	1.00
141_S	175_A	1.403	1.00
43_V	60_V	1.396	1.00
110_A	115_K	1.375	1.00
3_P	6_E	1.373	1.00
147_L	150_D	1.372	1.00
4_A	28_D	1.341	1.00
85_L	124_A	1.326	1.00
55_L	73_V	1.321	1.00
6_E	9_A	1.315	1.00
9_A	12_E	1.298	1.00
98_A	135_A	1.297	1.00
24_L	147_L	1.289	1.00
12_E	20_P	1.284	1.00
179_T	199_H	1.280	1.00
27_T	31_I	1.278	1.00
32_T	36_R	1.275	1.00
32_T	147_L	1.274	1.00
92_F	129_A	1.267	1.00
5_S	53_T	1.264	1.00
36_R	150_D	1.263	1.00
145_A	178_M	1.241	1.00
4_A	54_Q	1.239	1.00
90_D	93_A	1.229	1.00
190_A	202_D	1.228	1.00
56_R	62_I	1.225	1.00
53_T	56_R	1.218	1.00
165_R	168_T	1.206	1.00
148_A	152_L	1.203	1.00
19_T	22_E	1.197	1.00
160_L	179_T	1.193	1.00
184_R	202_D	1.191	1.00
10_R	14_L	1.191	1.00
106_I	123_Q	1.188	1.00
182_L	188_D	1.171	1.00
92_F	95_G	1.162	1.00
69_A	91_A	1.159	1.00
33_Y	137_L	1.148	1.00
184_R	188_D	1.145	1.00
10_R	13_G	1.141	1.00
122_V	136_V	1.135	1.00
201_L	207_I	1.121	1.00
8_A	23_V	1.121	1.00
18_A	22_E	1.103	1.00
46_I	88_A	1.100	1.00
35_Q	60_V	1.089	1.00
86_Q	115_K	1.088	1.00
90_D	115_K	1.086	1.00
74_A	122_V	1.086	1.00
24_L	151_R	1.065	1.00
38_H	41_A	1.062	1.00
87_A	91_A	1.059	1.00
71_V	98_A	1.053	1.00
89_V	128_V	1.052	1.00
88_A	125_V	1.050	1.00
171_A	195_A	1.046	1.00
184_R	190_A	1.038	1.00
165_R	187_V	1.030	1.00
106_I	167_D	1.029	1.00
86_Q	116_P	1.023	1.00
44_Y	91_A	1.018	0.99
74_A	99_L	1.015	0.99
105_D	168_T	1.012	0.99
12_E	17_D	1.011	0.99
135_A	143_T	1.011	0.99
146_R	150_D	1.008	0.99
101_G	136_V	0.997	0.99
49_D	52_T	0.994	0.99
118_S	122_V	0.993	0.99
182_L	200_V	0.989	0.99
30_T	102_T	0.988	0.99
24_L	148_A	0.985	0.99
44_Y	88_A	0.974	0.99
7_H	23_V	0.970	0.99
107_T	114_A	0.962	0.99
30_T	137_L	0.958	0.99
33_Y	100_V	0.949	0.99
96_T	131_R	0.945	0.99
31_I	35_Q	0.945	0.99
86_Q	90_D	0.943	0.99
180_T	198_D	0.934	0.99
54_Q	57_A	0.934	0.99
101_G	118_S	0.926	0.99
34_L	73_V	0.925	0.99
120_A	124_A	0.924	0.99
83_Q	87_A	0.923	0.99
149_V	156_P	0.917	0.99
33_Y	37_S	0.913	0.99
167_D	187_V	0.908	0.99
47_A	51_I	0.899	0.99
120_A	127_G	0.897	0.99
76_F	80_F	0.891	0.99
160_L	199_H	0.890	0.99
74_A	121_I	0.889	0.99
145_A	173_G	0.885	0.99
80_F	85_L	0.885	0.99
192_P	195_A	0.884	0.99
149_V	178_M	0.876	0.98
148_A	172_L	0.876	0.98
37_S	135_A	0.875	0.98
66_P	69_A	0.871	0.98
50_A	54_Q	0.869	0.98
105_D	109_P	0.866	0.98
76_F	108_I	0.857	0.98
6_E	53_T	0.851	0.98
174_A	180_T	0.844	0.98
6_E	50_A	0.843	0.98
154_V	158_E	0.828	0.98
7_H	25_T	0.826	0.98
147_L	151_R	0.825	0.98
104_P	126_A	0.824	0.98
103_D	168_T	0.820	0.98
53_T	57_A	0.818	0.98
28_D	54_Q	0.809	0.97
26_A	102_T	0.807	0.97
92_F	99_L	0.804	0.97
45_P	52_T	0.803	0.97
104_P	136_V	0.803	0.97
161_V	172_L	0.803	0.97
38_H	71_V	0.799	0.97
32_T	151_R	0.790	0.97
43_V	73_V	0.785	0.97
42_A	68_A	0.782	0.97
52_T	62_I	0.779	0.97
44_Y	72_V	0.773	0.97
79_A	83_Q	0.768	0.96
174_A	195_A	0.766	0.96
156_P	178_M	0.760	0.96
27_T	30_T	0.757	0.96
34_L	60_V	0.756	0.96
89_V	125_V	0.754	0.96
29_A	147_L	0.748	0.96
29_A	137_L	0.746	0.96
107_T	165_R	0.743	0.96
80_F	124_A	0.740	0.96
76_F	121_I	0.740	0.96
51_I	102_T	0.734	0.95
80_F	121_I	0.733	0.95
92_F	131_R	0.732	0.95
145_A	176_A	0.728	0.95
24_L	29_A	0.727	0.95
31_I	54_Q	0.726	0.95
52_T	56_R	0.725	0.95
21_G	151_R	0.711	0.95
32_T	58_A	0.708	0.94
33_Y	135_A	0.706	0.94
145_A	148_A	0.700	0.94
24_L	145_A	0.699	0.94
82_F	116_P	0.696	0.94
41_A	60_V	0.695	0.94
35_Q	58_A	0.694	0.94
69_A	75_G	0.693	0.94
142_E	175_A	0.689	0.94
170_V	174_A	0.679	0.93
98_A	131_R	0.677	0.93
193_A	196_Q	0.677	0.93
42_A	63_T	0.676	0.93
107_T	187_V	0.674	0.93
89_V	129_A	0.672	0.93
27_T	51_I	0.669	0.93
73_V	100_V	0.668	0.93
32_T	35_Q	0.666	0.92
49_D	56_R	0.662	0.92
109_P	113_G	0.655	0.92
72_V	88_A	0.650	0.92
31_I	55_L	0.645	0.91
104_P	122_V	0.639	0.91
131_R	135_A	0.637	0.91
22_E	151_R	0.632	0.90
114_A	187_V	0.631	0.90
143_T	146_R	0.631	0.90
149_V	176_A	0.629	0.90
99_L	131_R	0.627	0.90
166_P	193_A	0.626	0.90
5_S	57_A	0.624	0.90
26_A	105_D	0.624	0.90
17_D	22_E	0.622	0.90
89_V	121_I	0.622	0.90
41_A	61_A	0.622	0.90
86_Q	89_V	0.621	0.90
182_L	185_T	0.620	0.90
90_D	114_A	0.618	0.89
29_A	32_T	0.615	0.89
89_V	107_T	0.610	0.89
166_P	195_A	0.609	0.89
48_A	51_I	0.607	0.89
47_A	75_G	0.606	0.88
197_P	200_V	0.606	0.88
161_V	173_G	0.604	0.88
172_L	176_A	0.604	0.88
166_P	174_A	0.602	0.88
105_D	163_G	0.597	0.88
31_I	60_V	0.596	0.88
103_D	118_S	0.595	0.88
165_R	185_T	0.594	0.87
171_A	174_A	0.593	0.87
66_P	75_G	0.592	0.87
125_V	129_A	0.588	0.87
68_A	94_D	0.588	0.87
86_Q	112_D	0.586	0.87
8_A	19_T	0.585	0.87
120_A	128_V	0.583	0.86
65_D	68_A	0.583	0.86
117_G	187_V	0.582	0.86
201_L	206_E	0.579	0.86
71_V	74_A	0.574	0.86
93_A	129_A	0.569	0.85
24_L	144_T	0.568	0.85
26_A	103_D	0.568	0.85
155_P	159_C	0.566	0.85
161_V	176_A	0.565	0.85
166_P	170_V	0.565	0.85
142_E	176_A	0.563	0.85
40_G	61_A	0.561	0.84
170_V	173_G	0.560	0.84
181_A	207_I	0.557	0.84
46_I	80_F	0.555	0.84
108_I	118_S	0.554	0.84
144_T	172_L	0.549	0.83
11_L	25_T	0.549	0.83
8_A	17_D	0.549	0.83
47_A	168_T	0.548	0.83
190_A	200_V	0.546	0.83
80_F	84_D	0.545	0.83
44_Y	84_D	0.545	0.83
148_A	159_C	0.543	0.82
162_V	205_G	0.541	0.82
3_P	53_T	0.540	0.82
170_V	198_D	0.540	0.82
77_D	80_F	0.539	0.82
166_P	188_D	0.539	0.82
121_I	124_A	0.538	0.82
159_C	178_M	0.536	0.82
74_A	101_G	0.531	0.81
72_V	92_F	0.531	0.81
144_T	148_A	0.529	0.81
102_T	168_T	0.526	0.80
183_V	201_L	0.522	0.80
28_D	151_R	0.520	0.80
40_G	70_D	0.520	0.80
19_T	132_D	0.517	0.79
92_F	96_T	0.517	0.79
124_A	127_G	0.516	0.79
7_H	165_R	0.515	0.79
88_A	91_A	0.510	0.78
156_P	176_A	0.508	0.78
110_A	113_G	0.506	0.78
103_D	108_I	0.505	0.78
34_L	98_A	0.505	0.78
95_G	177_G	0.503	0.77
28_D	32_T	0.503	0.77
7_H	108_I	0.502	0.77
85_L	125_V	0.502	0.77
111_A	114_A	0.502	0.77
28_D	71_V	0.501	0.77
42_A	66_P	0.501	0.77
45_P	51_I	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3kc2A	2	0.967	100	0.43	Contact Map
2ho4A	1	0.9528	100	0.485	Contact Map
1zjjA	2	0.9811	100	0.499	Contact Map
4i9fA	2	0.9811	100	0.531	Contact Map
2oycA	2	0.9906	99.9	0.541	Contact Map
3pdwA	1	0.9528	99.9	0.552	Contact Map
3eprA	3	0.9811	99.9	0.555	Contact Map
1vjrA	1	0.9858	99.9	0.56	Contact Map
1yv9A	2	0.9764	99.9	0.577	Contact Map
2c4nA	3	0.9528	99.9	0.578	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.