Q9HR28 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR28 - Inosine-5'-monophosphate dehydrogenase

UniProt:	Q9HR28	Sequences: MSSIELTASQKTVLRALVDRYTQQETAVKGEAIADEVDRNPGTIRNQMQSLKALQLVEGVPGPKGGYKPTVDAYEALDIQQLDSAAEVPVTHEGEDITDVNVKKVNLTSVHHPELCRAEVHFRGSIRDIHDGDSVIVGPTPLSKLQVSGTVDGKDDAKGVVILKIDAMEAPADEPAH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (170)
Sequences:	134 (88)
Seq/√Len:	6.8

HALSA - Q9HR28

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_G	49_Q	3.281	0.88
42_G	46_N	3.129	0.85
52_K	168_M	2.769	0.77
135_V	162_I	2.598	0.72
16_A	75_E	2.438	0.67
7_T	156_D	2.301	0.62
38_D	156_D	2.209	0.59
44_I	55_Q	2.204	0.58
32_A	151_V	2.127	0.56
58_E	75_E	2.118	0.55
20_R	28_V	2.095	0.54
41_P	59_G	2.055	0.53
30_G	59_G	2.032	0.52
90_V	97_I	2.002	0.51
21_Y	163_L	1.984	0.50
103_K	147_V	1.907	0.47
6_L	10_Q	1.889	0.47
25_E	110_V	1.872	0.46
21_Y	108_T	1.869	0.46
54_L	163_L	1.836	0.45
26_T	32_A	1.831	0.44
20_R	165_I	1.808	0.44
40_N	48_M	1.795	0.43
18_V	169_E	1.737	0.41
30_G	41_P	1.721	0.40
34_A	46_N	1.721	0.40
150_T	166_D	1.700	0.40
27_A	101_N	1.685	0.39
78_D	121_H	1.681	0.39
39_R	48_M	1.644	0.38
125_S	128_D	1.637	0.37
34_A	42_G	1.635	0.37
90_V	137_V	1.605	0.36
9_S	44_I	1.588	0.36
57_V	140_T	1.587	0.36
18_V	147_V	1.535	0.34
35_D	151_V	1.531	0.34
44_I	104_K	1.514	0.33
92_H	130_H	1.483	0.32
49_Q	59_G	1.477	0.32
39_R	47_Q	1.465	0.31
31_E	61_P	1.443	0.31
162_I	170_A	1.432	0.30
69_P	118_A	1.421	0.30
151_V	161_V	1.419	0.30
74_Y	88_V	1.410	0.30
31_E	59_G	1.410	0.30
141_P	145_L	1.364	0.28
13_V	61_P	1.363	0.28
87_E	101_N	1.306	0.27
36_E	147_V	1.288	0.26
9_S	171_P	1.279	0.26
9_S	37_V	1.277	0.26
91_T	135_V	1.265	0.25
79_I	159_G	1.254	0.25
58_E	100_V	1.228	0.24
58_E	68_K	1.223	0.24
27_A	54_L	1.223	0.24
95_E	165_I	1.220	0.24
44_I	120_V	1.218	0.24
147_V	161_V	1.213	0.24
12_T	143_S	1.211	0.24
44_I	48_M	1.168	0.23
86_A	165_I	1.168	0.23
4_I	163_L	1.164	0.23
74_Y	133_D	1.164	0.23
12_T	15_R	1.155	0.22
94_G	107_L	1.153	0.22
120_V	131_D	1.147	0.22
157_A	162_I	1.146	0.22
81_Q	135_V	1.122	0.21
50_S	105_V	1.110	0.21
122_F	161_V	1.108	0.21
68_K	97_I	1.108	0.21
113_P	145_L	1.105	0.21
129_I	135_V	1.102	0.21
7_T	54_L	1.089	0.21
53_A	106_N	1.089	0.21
20_R	94_G	1.087	0.21
33_I	40_N	1.075	0.20
147_V	166_D	1.069	0.20
55_Q	152_D	1.061	0.20
9_S	143_S	1.061	0.20
16_A	53_A	1.051	0.20
115_L	161_V	1.046	0.20
21_Y	118_A	1.040	0.19
106_N	150_T	1.037	0.19
31_E	153_G	1.030	0.19
5_E	89_P	1.027	0.19
102_V	117_R	1.025	0.19
13_V	20_R	1.020	0.19
7_T	137_V	1.019	0.19
15_R	19_D	1.012	0.19
28_V	136_I	1.005	0.19
94_G	127_R	1.005	0.19
102_V	133_D	1.001	0.19
105_V	147_V	1.000	0.19
7_T	10_Q	0.991	0.18
100_V	126_I	0.991	0.18
30_G	83_D	0.990	0.18
143_S	154_K	0.989	0.18
54_L	156_D	0.989	0.18
31_E	49_Q	0.974	0.18
13_V	124_G	0.971	0.18
106_N	171_P	0.955	0.18
69_P	163_L	0.938	0.17
107_L	165_I	0.912	0.17
47_Q	60_V	0.910	0.17
31_E	41_P	0.908	0.17
59_G	109_S	0.907	0.17
4_I	143_S	0.907	0.17
18_V	21_Y	0.907	0.17
38_D	110_V	0.902	0.16
10_Q	133_D	0.895	0.16
8_A	135_V	0.895	0.16
40_N	127_R	0.892	0.16
8_A	157_A	0.889	0.16
37_V	102_V	0.882	0.16
97_I	167_A	0.877	0.16
18_V	92_H	0.873	0.16
75_E	115_L	0.869	0.16
103_K	161_V	0.863	0.16
39_R	116_C	0.862	0.16
8_A	76_A	0.856	0.15
13_V	79_I	0.849	0.15
16_A	167_A	0.849	0.15
120_V	165_I	0.848	0.15
86_A	125_S	0.847	0.15
36_E	121_H	0.845	0.15
20_R	29_K	0.841	0.15
49_Q	116_C	0.838	0.15
44_I	160_V	0.832	0.15
7_T	49_Q	0.831	0.15
78_D	87_E	0.830	0.15
74_Y	92_H	0.828	0.15
23_Q	121_H	0.826	0.15
76_A	150_T	0.821	0.15
8_A	52_K	0.806	0.15
18_V	167_A	0.798	0.14
91_T	96_D	0.795	0.14
80_Q	121_H	0.791	0.14
126_I	132_G	0.789	0.14
21_Y	69_P	0.789	0.14
13_V	33_I	0.773	0.14
53_A	111_H	0.770	0.14
48_M	120_V	0.769	0.14
150_T	164_K	0.768	0.14
10_Q	155_D	0.762	0.14
33_I	48_M	0.758	0.14
49_Q	155_D	0.755	0.14
93_E	163_L	0.754	0.14
99_D	118_A	0.753	0.14
16_A	37_V	0.749	0.13
19_D	22_T	0.742	0.13
30_G	153_G	0.737	0.13
49_Q	61_P	0.736	0.13
108_T	164_K	0.734	0.13
10_Q	145_L	0.733	0.13
25_E	125_S	0.733	0.13
99_D	134_S	0.727	0.13
28_V	173_D	0.726	0.13
47_Q	112_H	0.721	0.13
94_G	124_G	0.720	0.13
10_Q	54_L	0.719	0.13
129_I	167_A	0.719	0.13
47_Q	153_G	0.711	0.13
64_K	77_L	0.710	0.13
10_Q	56_L	0.702	0.13
16_A	76_A	0.701	0.13
88_V	142_L	0.696	0.13
136_I	146_Q	0.695	0.13
9_S	83_D	0.692	0.13
92_H	173_D	0.692	0.13
58_E	117_R	0.687	0.12
37_V	53_A	0.683	0.12
129_I	170_A	0.682	0.12
37_V	44_I	0.679	0.12
82_L	99_D	0.678	0.12
30_G	48_M	0.678	0.12
106_N	129_I	0.675	0.12
10_Q	43_T	0.674	0.12
82_L	97_I	0.674	0.12
41_P	48_M	0.673	0.12
54_L	61_P	0.671	0.12
97_I	134_S	0.671	0.12
60_V	133_D	0.670	0.12
54_L	74_Y	0.662	0.12
21_Y	72_D	0.659	0.12
12_T	162_I	0.658	0.12
103_K	122_F	0.648	0.12
124_G	172_A	0.645	0.12
4_I	111_H	0.641	0.12
30_G	79_I	0.640	0.12
48_M	59_G	0.640	0.12
38_D	128_D	0.637	0.12
93_E	167_A	0.633	0.12
107_L	151_V	0.627	0.11
34_A	69_P	0.627	0.11
27_A	110_V	0.626	0.11
4_I	117_R	0.626	0.11
25_E	152_D	0.626	0.11
13_V	31_E	0.623	0.11
37_V	50_S	0.620	0.11
89_P	124_G	0.617	0.11
116_C	140_T	0.615	0.11
98_T	104_K	0.614	0.11
97_I	147_V	0.607	0.11
93_E	137_V	0.603	0.11
39_R	60_V	0.600	0.11
47_Q	116_C	0.600	0.11
36_E	88_V	0.596	0.11
79_I	153_G	0.593	0.11
119_E	125_S	0.588	0.11
60_V	116_C	0.587	0.11
82_L	115_L	0.579	0.11
73_A	141_P	0.578	0.11
31_E	40_N	0.576	0.11
64_K	131_D	0.575	0.11
13_V	42_G	0.572	0.11
4_I	107_L	0.570	0.11
75_E	158_K	0.568	0.11
18_V	158_K	0.568	0.11
107_L	142_L	0.566	0.11
69_P	111_H	0.565	0.11
115_L	158_K	0.564	0.11
67_Y	70_T	0.562	0.11
136_I	147_V	0.559	0.10
109_S	129_I	0.553	0.10
48_M	116_C	0.549	0.10
87_E	131_D	0.545	0.10
72_D	83_D	0.543	0.10
111_H	171_P	0.538	0.10
33_I	124_G	0.536	0.10
79_I	137_V	0.534	0.10
61_P	144_K	0.533	0.10
58_E	115_L	0.533	0.10
31_E	141_P	0.530	0.10
78_D	122_F	0.529	0.10
12_T	32_A	0.527	0.10
86_A	90_V	0.527	0.10
80_Q	137_V	0.522	0.10
7_T	159_G	0.521	0.10
61_P	76_A	0.520	0.10
28_V	106_N	0.515	0.10
13_V	122_F	0.514	0.10
99_D	129_I	0.514	0.10
5_E	27_A	0.513	0.10
93_E	134_S	0.506	0.10
107_L	164_K	0.504	0.10
15_R	21_Y	0.504	0.10
23_Q	136_I	0.503	0.10
7_T	74_Y	0.502	0.10
114_E	126_I	0.502	0.10
78_D	102_V	0.501	0.10
148_S	167_A	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3k69A	2	0.7966	98.8	0.858	Contact Map
1ylfA	5	0.6893	98.6	0.864	Contact Map
4hf1A	2	0.7797	98.6	0.867	Contact Map
2y75A	5	0.6836	98.5	0.869	Contact Map
4hf0A	3	0.6723	98.5	0.87	Contact Map
3lwfA	5	0.7797	98.5	0.871	Contact Map
3t8rA	2	0.6441	98.4	0.872	Contact Map
4cicA	2	0.7627	98.4	0.873	Contact Map
1stzA	3	0.9548	98.4	0.874	Contact Map
1xmkA	1	0.4237	98.3	0.876	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.