Q9HR24 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR24 - Cytidine aminohydrolase

UniProt:	Q9HR24	Sequences: MDTDDLLAAARDATAAAHVPYSEYKVGAALDTASGAVYTGCNIENANYSNSLHAEEVAVGKAVSAGDTDFQRLAVTSSQRDAVTPCGMCRQTLAEFAADDLTILCDSGDDTAGVVTYTLGELLPDTITASNLDA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (126)
Sequences:	3323 (2276)
Seq/√Len:	202.8

ECOLI - CDD
BACSU - CDD
HALSA - Q9HR24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
50_N	88_M	3.770	1.00
33_A	69_D	3.133	1.00
61_K	65_A	2.751	1.00
34_S	67_D	2.596	1.00
59_V	93_L	2.304	1.00
32_T	38_Y	2.193	1.00
47_N	50_N	2.180	1.00
29_A	37_V	2.177	1.00
61_K	64_S	2.132	1.00
19_V	25_K	2.123	1.00
94_A	126_T	2.113	1.00
31_D	72_R	1.980	1.00
33_A	71_Q	1.972	1.00
77_S	83_V	1.914	1.00
9_A	39_T	1.913	1.00
9_A	12_D	1.902	1.00
36_A	67_D	1.824	1.00
38_Y	67_D	1.809	1.00
52_L	60_G	1.792	1.00
14_T	78_S	1.712	1.00
60_G	92_T	1.663	1.00
52_L	57_V	1.654	1.00
32_T	67_D	1.630	1.00
57_V	60_G	1.620	1.00
97_A	101_L	1.591	1.00
57_V	61_K	1.561	1.00
49_S	88_M	1.561	1.00
104_L	116_T	1.556	1.00
105_C	117_Y	1.535	1.00
63_V	96_F	1.484	1.00
38_Y	65_A	1.483	1.00
84_T	105_C	1.479	1.00
72_R	102_T	1.428	1.00
27_G	41_C	1.416	1.00
72_R	104_L	1.407	1.00
12_D	15_A	1.401	1.00
32_T	36_A	1.391	1.00
102_T	116_T	1.384	1.00
47_N	88_M	1.327	1.00
7_L	106_D	1.265	1.00
94_A	128_T	1.253	1.00
5_D	9_A	1.247	1.00
117_Y	121_E	1.236	1.00
117_Y	125_D	1.234	1.00
24_Y	83_V	1.227	1.00
7_L	74_A	1.222	1.00
31_D	71_Q	1.216	1.00
13_A	39_T	1.214	1.00
109_D	113_G	1.201	1.00
99_D	120_G	1.185	1.00
115_V	125_D	1.170	1.00
59_V	92_T	1.136	1.00
59_V	70_F	1.135	1.00
11_R	76_T	1.135	1.00
107_S	113_G	1.130	1.00
118_T	121_E	1.122	1.00
10_A	29_A	1.077	1.00
59_V	96_F	1.056	1.00
82_A	107_S	1.050	1.00
102_T	118_T	1.050	1.00
52_L	56_E	1.048	1.00
30_L	58_A	1.042	1.00
13_A	27_G	1.038	1.00
30_L	73_L	1.037	1.00
94_A	130_S	1.030	1.00
25_K	78_S	1.026	1.00
32_T	70_F	1.016	1.00
94_A	129_A	1.014	1.00
13_A	41_C	1.009	1.00
98_A	101_L	0.997	1.00
43_I	63_V	0.994	1.00
6_L	29_A	0.986	1.00
76_T	106_D	0.980	1.00
56_E	92_T	0.979	1.00
57_V	64_S	0.978	1.00
9_A	37_V	0.973	1.00
21_Y	48_Y	0.973	1.00
86_C	89_C	0.956	0.99
73_L	93_L	0.950	0.99
119_L	122_L	0.946	0.99
14_T	76_T	0.933	0.99
70_F	97_A	0.919	0.99
30_L	70_F	0.910	0.99
18_H	45_N	0.906	0.99
70_F	101_L	0.898	0.99
11_R	14_T	0.881	0.99
15_A	25_K	0.880	0.99
14_T	27_G	0.877	0.99
4_D	8_A	0.846	0.99
36_A	65_A	0.843	0.99
7_L	114_V	0.843	0.99
7_L	11_R	0.842	0.99
62_A	70_F	0.840	0.99
35_G	71_Q	0.829	0.98
16_A	39_T	0.817	0.98
12_D	39_T	0.812	0.98
105_C	125_D	0.804	0.98
14_T	25_K	0.796	0.98
103_I	119_L	0.784	0.98
103_I	122_L	0.782	0.98
93_L	101_L	0.777	0.98
41_C	57_V	0.773	0.98
87_G	123_L	0.767	0.97
6_L	37_V	0.761	0.97
5_D	8_A	0.760	0.97
8_A	12_D	0.751	0.97
109_D	112_A	0.749	0.97
58_A	73_L	0.740	0.97
93_L	97_A	0.736	0.97
47_N	51_S	0.734	0.97
43_I	64_S	0.731	0.97
11_R	106_D	0.731	0.97
73_L	101_L	0.718	0.96
52_L	92_T	0.714	0.96
100_D	120_G	0.713	0.96
14_T	17_A	0.700	0.96
43_I	60_G	0.698	0.96
93_L	119_L	0.691	0.95
101_L	119_L	0.686	0.95
82_A	114_V	0.683	0.95
12_D	16_A	0.681	0.95
88_M	92_T	0.680	0.95
56_E	60_G	0.676	0.95
63_V	70_F	0.673	0.95
55_E	86_C	0.670	0.94
79_Q	82_A	0.668	0.94
6_L	74_A	0.666	0.94
45_N	95_E	0.660	0.94
41_C	64_S	0.653	0.94
87_G	90_R	0.647	0.93
128_T	131_N	0.643	0.93
8_A	11_R	0.639	0.93
74_A	106_D	0.637	0.93
59_V	97_A	0.634	0.93
18_H	21_Y	0.633	0.93
74_A	104_L	0.633	0.93
21_Y	45_N	0.631	0.92
82_A	108_G	0.625	0.92
13_A	64_S	0.620	0.92
56_E	88_M	0.618	0.92
63_V	68_T	0.616	0.92
10_A	74_A	0.615	0.92
9_A	13_A	0.613	0.91
28_A	58_A	0.612	0.91
81_D	84_T	0.612	0.91
78_S	108_G	0.604	0.91
106_D	114_V	0.603	0.91
24_Y	77_S	0.601	0.91
80_R	109_D	0.601	0.91
84_T	90_R	0.599	0.90
66_G	70_F	0.596	0.90
10_A	76_T	0.585	0.89
31_D	37_V	0.579	0.89
26_V	54_A	0.576	0.89
99_D	102_T	0.562	0.87
87_G	91_Q	0.562	0.87
50_N	92_T	0.561	0.87
6_L	10_A	0.558	0.87
53_H	56_E	0.556	0.87
16_A	64_S	0.555	0.87
45_N	49_S	0.549	0.86
30_L	62_A	0.547	0.86
84_T	125_D	0.547	0.86
82_A	105_C	0.543	0.86
48_Y	51_S	0.540	0.85
123_L	127_I	0.540	0.85
53_H	89_C	0.539	0.85
123_L	126_T	0.539	0.85
14_T	77_S	0.538	0.85
55_E	89_C	0.537	0.85
73_L	103_I	0.532	0.84
53_H	86_C	0.529	0.84
13_A	17_A	0.527	0.84
94_A	119_L	0.527	0.84
11_R	108_G	0.525	0.84
107_S	114_V	0.524	0.84
41_C	63_V	0.520	0.83
84_T	131_N	0.516	0.83
33_A	67_D	0.513	0.82
85_P	90_R	0.511	0.82
90_R	122_L	0.511	0.82
32_T	62_A	0.508	0.82
18_H	95_E	0.508	0.82
56_E	62_A	0.508	0.82
26_V	42_N	0.507	0.82
5_D	31_D	0.506	0.81
4_D	114_V	0.506	0.81
86_C	91_Q	0.504	0.81
16_A	68_T	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d30A	4	0.9254	100	0.053	Contact Map
3dmoA	4	0.9552	100	0.081	Contact Map
1cttA	2	0.9104	100	0.172	Contact Map
3b8fA	4	0.9627	100	0.173	Contact Map
1uwzA	4	0.9701	100	0.236	Contact Map
2fr5A	6	0.9776	100	0.244	Contact Map
1r5tA	4	0.9776	100	0.247	Contact Map
3mpzA	4	0.9179	100	0.259	Contact Map
3r2nA	4	0.8806	100	0.279	Contact Map
3oj6A	4	0.9403	100	0.298	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.