Q9HR14 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HR14 - Uncharacterized protein

UniProt:	Q9HR14	Sequences: MTTAQHATAVPAGETPAAVCEYCQRPFPSATRLTLHKGTDHPQRIDDAERAAFQDAYLAEEDDLRSFRLRALAVLVLVYFGFLIMYAILA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	90 (72)
Sequences:	15756 (12973)
Seq/√Len:	1528.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_E	46_D	3.214	1.00
5_Q	34_T	2.519	1.00
8_T	37_K	2.437	1.00
30_A	55_D	2.330	1.00
18_A	44_R	2.259	1.00
22_Y	47_D	2.179	1.00
5_Q	59_A	1.967	1.00
8_T	62_D	1.935	1.00
37_K	62_D	1.930	1.00
34_T	59_A	1.853	1.00
25_R	50_R	1.724	1.00
26_P	51_A	1.658	1.00
18_A	26_P	1.644	1.00
54_Q	57_Y	1.594	1.00
30_A	34_T	1.563	1.00
6_H	35_L	1.563	1.00
3_T	6_H	1.546	1.00
46_D	74_V	1.484	1.00
21_E	74_V	1.438	1.00
44_R	51_A	1.436	1.00
28_P	53_F	1.402	1.00
24_Q	49_E	1.392	1.00
55_D	59_A	1.371	1.00
29_S	32_R	1.293	1.00
18_A	24_Q	1.252	1.00
6_H	60_E	1.241	1.00
29_S	54_Q	1.222	1.00
44_R	72_L	1.206	1.00
22_Y	37_K	1.187	1.00
35_L	60_E	1.169	1.00
27_F	52_A	1.123	1.00
21_E	37_K	1.114	1.00
31_T	56_A	1.110	1.00
28_P	32_R	1.076	1.00
46_D	62_D	1.070	1.00
9_A	38_G	1.041	1.00
32_R	35_L	1.020	1.00
6_H	29_S	1.019	1.00
72_L	75_L	0.992	1.00
27_F	50_R	0.989	1.00
3_T	32_R	0.989	1.00
57_Y	60_E	0.980	1.00
18_A	72_L	0.967	1.00
7_A	11_P	0.952	1.00
5_Q	8_T	0.939	1.00
44_R	49_E	0.927	1.00
53_F	57_Y	0.893	1.00
22_Y	75_L	0.889	1.00
10_V	64_L	0.886	1.00
18_A	21_E	0.872	1.00
34_T	37_K	0.869	1.00
17_A	20_C	0.867	1.00
20_C	36_H	0.843	1.00
3_T	57_Y	0.840	1.00
25_R	52_A	0.823	1.00
47_D	62_D	0.812	1.00
59_A	62_D	0.796	1.00
47_D	75_L	0.776	1.00
32_R	57_Y	0.772	1.00
38_G	63_D	0.761	1.00
15_T	41_H	0.753	1.00
66_S	69_L	0.742	1.00
9_A	63_D	0.741	1.00
6_H	9_A	0.739	1.00
36_H	40_D	0.736	1.00
45_I	48_A	0.718	1.00
10_V	39_T	0.712	1.00
48_A	61_E	0.708	1.00
69_L	73_A	0.696	1.00
31_T	35_L	0.686	1.00
43_Q	48_A	0.679	1.00
17_A	36_H	0.665	1.00
62_D	66_S	0.637	1.00
20_C	23_C	0.637	1.00
23_C	36_H	0.632	1.00
70_R	73_A	0.623	1.00
11_P	17_A	0.615	1.00
43_Q	55_D	0.614	1.00
48_A	52_A	0.612	1.00
71_A	75_L	0.610	1.00
35_L	38_G	0.609	1.00
45_I	61_E	0.603	1.00
17_A	43_Q	0.602	1.00
9_A	16_P	0.595	1.00
29_S	33_L	0.590	1.00
17_A	40_D	0.578	1.00
33_L	36_H	0.575	1.00
9_A	14_E	0.570	1.00
56_A	60_E	0.565	1.00
39_T	53_F	0.565	1.00
44_R	47_D	0.563	1.00
12_A	15_T	0.563	1.00
46_D	51_A	0.562	1.00
30_A	37_K	0.562	1.00
10_V	28_P	0.554	1.00
16_P	26_P	0.550	1.00
13_G	28_P	0.543	1.00
5_Q	9_A	0.541	1.00
23_C	40_D	0.534	1.00
4_A	58_L	0.531	1.00
27_F	33_L	0.522	1.00
45_I	65_R	0.515	1.00
54_Q	58_L	0.515	1.00
35_L	39_T	0.510	1.00
68_R	71_A	0.508	1.00
13_G	16_P	0.504	1.00
12_A	16_P	0.504	1.00
42_P	53_F	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i13A	1	0.9889	99.4	0.28	Contact Map
2n25A	1	0.2889	99.4	0.292	Contact Map
3w5kB	1	0.9556	99.4	0.293	Contact Map
1x6hA	1	0.8778	99.4	0.294	Contact Map
2dmiA	1	0.9889	99.4	0.3	Contact Map
2dlqA	1	0.9889	99.4	0.308	Contact Map
3zmsC	1	0	99.4	0.311	Contact Map
2jp9A	1	0.9889	99.3	0.323	Contact Map
2lt7A	1	0.9889	99.3	0.323	Contact Map
2ctdA	1	0.8333	99.3	0.329	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.