Q9HQZ4 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQZ4 - NADH oxidase

UniProt:	Q9HQZ4	Sequences: MADADRTTDADALIDGLRTRRSGHNFDPDADIDDDTLAELIRDATLAPSSYNLQPWEFVAVQDDDRLAELAEIAYDQQHIVDAGTAILVAGHTDPKTADRVFEEWVDAGRFDADTGAELKSQTVASYESDQAGRDYAIRNASLAAQNLLLSAHARGLTATPMSGFDFEAAAEFAGLPADTVPVVLIAVGPSGGEEPDRLPRRSVDEVLHRESM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	213 (181)
Sequences:	10787 (8226)
Seq/√Len:	611.4

ECOLI - NFNB NFSA RUTE YDJA
BACSU - YODC YDGI YFKO MHQN NFRA1 YFHC NFRA2
HALSA - Q9HQZ4
SULSO - Q97VQ3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_D	30_A	4.471	1.00
39_E	155_R	3.641	1.00
33_D	36_T	3.507	1.00
34_D	62_Q	2.991	1.00
34_D	38_A	2.723	1.00
30_A	190_P	2.686	1.00
58_F	144_A	2.517	1.00
57_E	209_H	2.489	1.00
158_T	191_S	2.259	1.00
42_R	45_T	2.216	1.00
40_L	152_A	2.210	1.00
19_T	153_H	2.181	1.00
36_T	155_R	2.141	1.00
69_E	173_F	2.080	1.00
157_L	190_P	2.029	1.00
149_L	159_A	1.959	1.00
64_D	68_A	1.931	1.00
44_A	148_L	1.918	1.00
43_D	151_S	1.894	1.00
15_D	19_T	1.864	1.00
27_D	192_G	1.796	1.00
145_A	184_V	1.786	1.00
25_N	192_G	1.773	1.00
171_A	182_P	1.736	1.00
36_T	157_L	1.733	1.00
66_R	69_E	1.670	1.00
13_L	17_L	1.650	1.00
149_L	161_P	1.635	1.00
73_I	169_A	1.618	1.00
12_A	15_D	1.589	1.00
18_R	46_L	1.580	1.00
145_A	186_I	1.558	1.00
202_R	206_E	1.529	1.00
40_L	148_L	1.506	1.00
13_L	16_G	1.504	1.00
14_I	18_R	1.484	1.00
166_D	169_A	1.472	1.00
31_D	62_Q	1.467	1.00
153_H	158_T	1.438	1.00
90_A	180_T	1.427	1.00
58_F	87_I	1.424	1.00
152_A	188_V	1.420	1.00
204_V	208_L	1.418	1.00
139_R	142_S	1.418	1.00
157_L	188_V	1.414	1.00
14_I	39_E	1.412	1.00
169_A	172_E	1.409	1.00
70_L	170_A	1.372	1.00
11_D	15_D	1.356	1.00
41_I	208_L	1.349	1.00
149_L	186_I	1.343	1.00
73_I	173_F	1.334	1.00
40_L	157_L	1.319	1.00
40_L	188_V	1.311	1.00
63_D	66_R	1.287	1.00
68_A	72_E	1.279	1.00
71_A	81_V	1.262	1.00
143_L	146_Q	1.256	1.00
38_A	205_D	1.254	1.00
36_T	190_P	1.248	1.00
26_F	187_A	1.246	1.00
36_T	39_E	1.237	1.00
78_Q	82_D	1.234	1.00
152_A	159_A	1.232	1.00
141_A	183_V	1.227	1.00
66_R	173_F	1.218	1.00
14_I	43_D	1.218	1.00
45_T	207_V	1.210	1.00
43_D	155_R	1.201	1.00
57_E	180_T	1.184	1.00
32_I	157_L	1.149	1.00
64_D	67_L	1.145	1.00
65_D	68_A	1.142	1.00
22_S	160_T	1.131	1.00
38_A	204_V	1.114	1.00
125_A	128_E	1.107	1.00
191_S	194_E	1.104	1.00
18_R	42_R	1.089	1.00
14_I	155_R	1.087	1.00
47_A	147_N	1.085	1.00
69_E	72_E	1.083	1.00
169_A	173_F	1.074	1.00
138_I	183_V	1.062	1.00
151_S	155_R	1.050	1.00
68_A	81_V	1.043	1.00
87_I	148_L	1.042	1.00
50_S	136_Y	1.037	1.00
12_A	154_A	1.035	1.00
98_A	101_V	1.035	1.00
38_A	42_R	1.032	1.00
159_A	186_I	1.028	1.00
159_A	188_V	1.021	1.00
165_F	185_L	1.009	1.00
17_L	147_N	1.009	1.00
35_D	38_A	1.008	1.00
161_P	184_V	1.006	1.00
78_Q	81_V	1.006	1.00
11_D	154_A	0.998	1.00
65_D	69_E	0.997	1.00
60_A	208_L	0.985	1.00
168_E	172_E	0.985	1.00
100_R	104_E	0.983	1.00
145_A	161_P	0.979	1.00
15_D	18_R	0.976	1.00
100_R	103_E	0.961	1.00
41_I	44_A	0.957	1.00
33_D	190_P	0.951	1.00
101_V	104_E	0.949	1.00
99_D	103_E	0.944	1.00
147_N	150_L	0.936	1.00
160_T	187_A	0.936	1.00
39_E	43_D	0.925	1.00
32_I	190_P	0.916	1.00
59_V	90_A	0.912	1.00
148_L	188_V	0.911	1.00
134_R	181_V	0.899	1.00
151_S	154_A	0.898	1.00
58_F	89_V	0.893	1.00
97_T	100_R	0.892	1.00
103_E	107_D	0.880	1.00
59_V	180_T	0.879	1.00
148_L	186_I	0.875	1.00
42_R	204_V	0.874	1.00
104_E	107_D	0.872	1.00
104_E	108_A	0.869	1.00
97_T	101_V	0.869	1.00
91_G	137_A	0.860	1.00
101_V	105_W	0.856	1.00
146_Q	150_L	0.854	1.00
176_L	180_T	0.852	1.00
72_E	76_D	0.850	1.00
162_M	187_A	0.848	1.00
136_Y	163_S	0.847	1.00
13_L	150_L	0.841	1.00
27_D	190_P	0.840	1.00
17_L	150_L	0.834	1.00
143_L	147_N	0.832	1.00
88_L	185_L	0.820	1.00
31_D	64_D	0.815	1.00
60_A	85_T	0.812	1.00
39_E	42_R	0.809	1.00
41_I	60_A	0.806	1.00
102_F	107_D	0.801	1.00
89_V	148_L	0.800	1.00
13_L	154_A	0.797	1.00
171_A	181_V	0.795	1.00
142_S	161_P	0.795	1.00
69_E	73_I	0.792	1.00
203_S	206_E	0.790	1.00
40_L	155_R	0.782	1.00
68_A	71_A	0.781	1.00
139_R	163_S	0.775	1.00
16_G	154_A	0.771	1.00
102_F	105_W	0.765	1.00
25_N	193_G	0.758	1.00
167_F	182_P	0.756	1.00
37_L	188_V	0.756	1.00
99_D	106_V	0.748	1.00
37_L	41_I	0.736	1.00
56_W	141_A	0.732	1.00
140_N	163_S	0.731	1.00
98_A	102_F	0.729	1.00
26_F	160_T	0.727	1.00
135_D	138_I	0.726	1.00
177_P	180_T	0.723	1.00
138_I	142_S	0.723	1.00
14_I	154_A	0.723	1.00
77_Q	81_V	0.722	1.00
105_W	108_A	0.721	1.00
50_S	163_S	0.719	1.00
100_R	206_E	0.714	1.00
49_S	56_W	0.714	1.00
30_A	33_D	0.713	1.00
202_R	207_V	0.709	1.00
79_H	83_A	0.708	1.00
37_L	85_T	0.705	1.00
167_F	171_A	0.704	1.00
35_D	39_E	0.702	1.00
135_D	139_R	0.698	1.00
143_L	161_P	0.696	1.00
59_V	174_A	0.685	1.00
67_L	71_A	0.683	1.00
139_R	143_L	0.677	1.00
101_V	106_V	0.676	1.00
61_V	66_R	0.675	1.00
61_V	174_A	0.673	1.00
103_E	106_V	0.672	1.00
32_I	36_T	0.671	1.00
32_I	35_D	0.671	1.00
170_A	173_F	0.671	1.00
11_D	16_G	0.668	1.00
102_F	106_V	0.667	1.00
79_H	82_D	0.666	1.00
177_P	209_H	0.665	1.00
44_A	58_F	0.662	1.00
27_D	193_G	0.659	1.00
146_Q	149_L	0.653	1.00
83_A	86_A	0.647	1.00
46_L	198_R	0.644	1.00
98_A	104_E	0.643	1.00
171_A	176_L	0.641	1.00
129_S	132_A	0.637	1.00
74_A	80_I	0.636	1.00
89_V	93_T	0.628	1.00
48_P	159_A	0.620	1.00
97_T	102_F	0.619	1.00
89_V	145_A	0.616	1.00
50_S	140_N	0.612	1.00
23_G	191_S	0.610	1.00
167_F	181_V	0.610	1.00
87_I	188_V	0.607	1.00
168_E	171_A	0.605	1.00
17_L	43_D	0.603	1.00
94_D	179_D	0.600	1.00
126_S	182_P	0.598	1.00
92_H	95_P	0.595	1.00
13_L	151_S	0.595	1.00
86_A	187_A	0.595	1.00
66_R	174_A	0.594	1.00
89_V	141_A	0.594	1.00
80_I	83_A	0.593	1.00
36_T	40_L	0.591	1.00
73_I	170_A	0.590	1.00
17_L	154_A	0.589	1.00
71_A	75_Y	0.588	1.00
91_G	95_P	0.587	1.00
14_I	151_S	0.582	1.00
165_F	170_A	0.578	1.00
37_L	60_A	0.577	1.00
16_G	150_L	0.574	1.00
86_A	185_L	0.573	1.00
81_V	84_G	0.573	1.00
98_A	105_W	0.573	1.00
56_W	207_V	0.572	1.00
138_I	181_V	0.568	1.00
150_L	154_A	0.568	1.00
82_D	85_T	0.567	1.00
144_A	207_V	0.567	1.00
72_E	173_F	0.565	1.00
100_R	108_A	0.563	1.00
49_S	54_Q	0.563	1.00
59_V	209_H	0.562	1.00
90_A	93_T	0.561	1.00
24_H	160_T	0.558	1.00
70_L	185_L	0.556	1.00
41_I	207_V	0.555	1.00
27_D	31_D	0.554	1.00
77_Q	80_I	0.546	0.99
74_A	185_L	0.541	0.99
145_A	149_L	0.539	0.99
99_D	108_A	0.538	0.99
62_Q	85_T	0.533	0.99
40_L	44_A	0.532	0.99
56_W	144_A	0.528	0.99
24_H	79_H	0.528	0.99
100_R	105_W	0.526	0.99
25_N	194_E	0.525	0.99
32_I	37_L	0.525	0.99
93_T	181_V	0.524	0.99
71_A	77_Q	0.519	0.99
71_A	76_D	0.518	0.99
142_S	146_Q	0.518	0.99
136_Y	140_N	0.514	0.99
45_T	204_V	0.512	0.99
18_R	43_D	0.512	0.99
144_A	148_L	0.512	0.99
139_R	184_V	0.511	0.99
88_L	174_A	0.509	0.99
139_R	183_V	0.506	0.99
61_V	70_L	0.504	0.99
20_R	159_A	0.501	0.99
170_A	185_L	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qlxA	2	0.9906	100	0.233	Contact Map
3gagA	4	0.9577	100	0.233	Contact Map
3ge6A	2	0.9624	100	0.235	Contact Map
3gbhA	3	0.9718	100	0.241	Contact Map
3of4A	3	0.939	100	0.243	Contact Map
2h0uA	2	0.8638	100	0.248	Contact Map
1noxA	2	0.9202	100	0.254	Contact Map
3bemA	2	0.9671	100	0.254	Contact Map
1icrA	2	0.939	100	0.255	Contact Map
2hayA	2	0.9765	100	0.257	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.