Q9HQY8 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQY8 - Chemotaxis protein

UniProt:	Q9HQY8	Sequences: MSDDETDVLEFSLGAGRYCIDIAHVDEIVDAGEDVTPIPNSEQHVIGVVDLRGETTTVVDPRVKLGEDGAADGTRIVVLSDHDATGLLVDDVHEVEAVGEAALDESAASETTRGIIRRDDRFVVWVEPDALV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (126)
Sequences:	4445 (3100)
Seq/√Len:	276.1

ECOLI - CHEW
BACSU - CHEW
HALSA - Q9HQY8 Q9HQW5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_R	121_R	3.595	1.00
104_D	117_R	3.285	1.00
76_I	86_G	2.873	1.00
7_D	97_A	2.806	1.00
27_E	52_R	2.806	1.00
98_V	116_I	2.677	1.00
46_I	60_D	2.573	1.00
46_I	63_V	2.513	1.00
26_D	80_S	2.455	1.00
24_H	129_D	2.446	1.00
103_L	114_G	2.269	1.00
46_I	88_L	2.239	1.00
12_S	91_D	2.224	1.00
99_G	102_A	2.121	1.00
62_R	90_D	2.082	1.00
79_L	87_L	2.057	1.00
31_A	35_V	1.911	1.00
50_D	53_G	1.865	1.00
113_R	127_E	1.845	1.00
63_V	69_G	1.766	1.00
71_A	74_T	1.756	1.00
110_E	130_A	1.674	1.00
58_V	76_I	1.670	1.00
6_T	21_D	1.630	1.00
118_R	121_R	1.565	1.00
50_D	55_T	1.556	1.00
54_E	84_A	1.548	1.00
30_D	75_R	1.541	1.00
31_A	88_L	1.493	1.00
6_T	100_E	1.484	1.00
112_T	124_V	1.441	1.00
12_S	93_H	1.435	1.00
26_D	54_E	1.432	1.00
17_R	93_H	1.430	1.00
21_D	113_R	1.414	1.00
10_E	17_R	1.413	1.00
103_L	125_W	1.394	1.00
14_G	62_R	1.350	1.00
43_Q	63_V	1.342	1.00
58_V	86_G	1.342	1.00
21_D	24_H	1.325	1.00
31_A	76_I	1.305	1.00
8_V	125_W	1.280	1.00
56_T	78_V	1.279	1.00
8_V	116_I	1.279	1.00
9_L	75_R	1.214	1.00
102_A	118_R	1.213	1.00
5_E	97_A	1.201	1.00
26_D	84_A	1.179	1.00
60_D	63_V	1.172	1.00
9_L	77_V	1.164	1.00
49_V	76_I	1.156	1.00
20_I	79_L	1.137	1.00
25_V	77_V	1.104	1.00
127_E	130_A	1.055	1.00
10_E	93_H	1.041	1.00
61_P	87_L	1.020	1.00
12_S	15_A	1.008	1.00
10_E	96_E	1.004	1.00
87_L	128_P	0.999	1.00
81_D	129_D	0.995	1.00
60_D	69_G	0.992	1.00
8_V	98_V	0.984	1.00
118_R	123_V	0.963	1.00
32_G	76_I	0.950	1.00
11_F	77_V	0.950	1.00
20_I	128_P	0.924	1.00
29_V	76_I	0.922	1.00
32_G	35_V	0.914	1.00
116_I	125_W	0.912	1.00
6_T	113_R	0.911	1.00
61_P	131_L	0.910	1.00
44_H	64_K	0.904	1.00
35_V	58_V	0.896	1.00
24_H	113_R	0.883	1.00
62_R	67_E	0.876	1.00
5_E	100_E	0.865	1.00
51_L	78_V	0.864	1.00
19_C	116_I	0.849	1.00
60_D	64_K	0.849	1.00
24_H	128_P	0.845	1.00
19_C	123_V	0.831	1.00
29_V	51_L	0.822	0.99
14_G	67_E	0.818	0.99
31_A	75_R	0.814	0.99
45_V	57_T	0.809	0.99
106_S	112_T	0.799	0.99
49_V	58_V	0.798	0.99
79_L	128_P	0.794	0.99
74_T	88_L	0.778	0.99
77_V	89_V	0.775	0.99
96_E	121_R	0.769	0.99
76_I	88_L	0.769	0.99
9_L	28_I	0.768	0.99
5_E	99_G	0.767	0.99
29_V	32_G	0.766	0.99
15_A	101_A	0.766	0.99
12_S	17_R	0.747	0.99
13_L	61_P	0.744	0.99
30_D	122_F	0.741	0.99
27_E	92_V	0.738	0.99
64_K	107_A	0.721	0.99
35_V	49_V	0.719	0.99
19_C	125_W	0.718	0.99
12_S	96_E	0.713	0.99
36_T	50_D	0.706	0.98
115_I	122_F	0.703	0.98
11_F	65_L	0.702	0.98
9_L	25_V	0.689	0.98
40_N	43_Q	0.688	0.98
74_T	90_D	0.687	0.98
98_V	103_L	0.685	0.98
22_I	29_V	0.685	0.98
20_I	25_V	0.683	0.98
109_S	130_A	0.677	0.98
27_E	51_L	0.676	0.98
114_G	125_W	0.675	0.98
67_E	70_A	0.665	0.98
62_R	68_D	0.663	0.98
38_I	48_V	0.661	0.98
10_E	94_E	0.660	0.98
38_I	104_D	0.655	0.97
64_K	111_T	0.651	0.97
79_L	131_L	0.648	0.97
60_D	70_A	0.647	0.97
44_H	63_V	0.643	0.97
11_F	20_I	0.640	0.97
9_L	115_I	0.638	0.97
8_V	100_E	0.635	0.97
7_D	22_I	0.634	0.97
82_H	101_A	0.633	0.97
29_V	92_V	0.631	0.97
43_Q	100_E	0.630	0.97
117_R	122_F	0.629	0.97
38_I	41_S	0.629	0.97
62_R	69_G	0.627	0.97
31_A	74_T	0.625	0.97
11_F	27_E	0.619	0.96
13_L	85_T	0.617	0.96
70_A	90_D	0.614	0.96
46_I	69_G	0.610	0.96
18_Y	65_L	0.602	0.96
49_V	78_V	0.596	0.96
29_V	49_V	0.596	0.96
36_T	39_P	0.594	0.95
124_V	127_E	0.593	0.95
72_D	83_D	0.592	0.95
35_V	51_L	0.591	0.95
9_L	30_D	0.583	0.95
56_T	84_A	0.582	0.95
48_V	124_V	0.578	0.95
80_S	84_A	0.575	0.95
38_I	55_T	0.574	0.95
32_G	56_T	0.569	0.94
39_P	45_V	0.568	0.94
13_L	111_T	0.567	0.94
41_S	45_V	0.565	0.94
69_G	102_A	0.561	0.94
71_A	75_R	0.560	0.94
71_A	90_D	0.557	0.94
18_Y	25_V	0.556	0.94
102_A	117_R	0.553	0.93
69_G	110_E	0.549	0.93
57_T	74_T	0.549	0.93
5_E	23_A	0.548	0.93
15_A	70_A	0.542	0.93
28_I	50_D	0.542	0.93
32_G	49_V	0.540	0.93
55_T	77_V	0.540	0.93
35_V	76_I	0.539	0.93
97_A	100_E	0.538	0.92
38_I	50_D	0.537	0.92
17_R	123_V	0.537	0.92
45_V	59_V	0.536	0.92
8_V	19_C	0.531	0.92
36_T	55_T	0.527	0.92
66_G	109_S	0.527	0.92
29_V	54_E	0.527	0.92
57_T	64_K	0.523	0.91
37_P	130_A	0.523	0.91
38_I	53_G	0.520	0.91
48_V	115_I	0.515	0.91
23_A	26_D	0.512	0.91
10_E	123_V	0.511	0.90
90_D	95_V	0.508	0.90
75_R	91_D	0.506	0.90
40_N	93_H	0.506	0.90
55_T	124_V	0.503	0.90
9_L	29_V	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ho9A	1	0.9924	99.9	0.207	Contact Map
4jpbW	1	0.9697	99.9	0.216	Contact Map
2qdlA	1	0.9924	99.9	0.218	Contact Map
1b3qA	2	0.9545	99.3	0.555	Contact Map
1zq1A	2	0.8182	7.3	0.921	Contact Map
4o0aA	1	0.7197	6.9	0.922	Contact Map
1rqbA	2	0	5	0.927	Contact Map
2xheA	1	0.3864	4.8	0.928	Contact Map
3shqA	1	0.8788	4.3	0.929	Contact Map
3ll7A	1	0.6742	4.1	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.