Q9HQW5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQW5 - Chemotaxis protein

UniProt:	Q9HQW5	Sequences: MNLEDADRVVEEAAHVVEFKLGDEVCAIDIAAVDSIVESKQVTRVPRAPDAVEGVMDLRGETTAIVDPREFLAIHGDHDSDNILVLDRADDKQKIGLRVAEVTEVSGYAEHQIDRGSRLDRIGTSAIESELVRGVIRKGATPPGEADAAEEDVALVLWLDIDKLIGSVSADETIDNQV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (142)
Sequences:	4408 (3087)
Seq/√Len:	259.1

ECOLI - CHEW
BACSU - CHEW
HALSA - Q9HQW5 Q9HQY8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_V	154_A	4.069	1.00
114_D	137_R	3.595	1.00
83_I	96_G	3.286	1.00
15_H	107_G	3.225	1.00
108_Y	136_I	2.986	1.00
53_E	67_D	2.974	1.00
113_I	134_G	2.868	1.00
34_D	87_D	2.749	1.00
35_S	59_R	2.618	1.00
53_E	98_R	2.582	1.00
32_A	162_D	2.568	1.00
53_E	70_E	2.503	1.00
109_A	112_Q	2.390	1.00
20_K	101_E	2.386	1.00
86_L	97_L	2.291	1.00
69_R	100_A	2.255	1.00
65_I	83_I	2.033	1.00
133_R	160_D	2.023	1.00
70_E	76_G	1.983	1.00
39_S	42_V	1.978	1.00
130_E	163_K	1.970	1.00
57_D	60_G	1.926	1.00
14_A	29_D	1.760	1.00
38_E	82_N	1.717	1.00
57_D	62_T	1.708	1.00
12_E	110_E	1.569	1.00
61_E	94_K	1.562	1.00
132_V	157_L	1.556	1.00
138_K	154_A	1.515	1.00
50_D	70_E	1.502	1.00
20_K	103_T	1.484	1.00
39_S	98_R	1.479	1.00
139_G	154_A	1.473	1.00
14_A	110_E	1.398	1.00
113_I	158_W	1.398	1.00
39_S	83_I	1.397	1.00
16_V	158_W	1.393	1.00
65_I	96_G	1.372	1.00
17_V	82_N	1.338	1.00
112_Q	138_K	1.332	1.00
17_V	84_L	1.327	1.00
29_D	133_R	1.302	1.00
68_P	164_L	1.301	1.00
40_K	83_I	1.282	1.00
11_E	111_H	1.263	1.00
18_E	25_V	1.244	1.00
28_I	86_L	1.227	1.00
34_D	61_E	1.211	1.00
71_F	169_S	1.203	1.00
56_M	83_I	1.180	1.00
63_T	85_V	1.148	1.00
22_G	69_R	1.141	1.00
81_D	98_R	1.127	1.00
67_D	71_F	1.111	1.00
29_D	32_A	1.107	1.00
19_F	84_L	1.097	1.00
18_E	106_S	1.085	1.00
67_D	76_G	1.081	1.00
136_I	158_W	1.072	1.00
16_V	136_I	1.065	1.00
25_V	103_T	1.059	1.00
58_L	85_V	1.056	1.00
33_V	84_L	1.050	1.00
34_D	94_K	1.035	1.00
138_K	156_V	1.033	1.00
22_G	74_I	1.019	1.00
37_V	83_I	1.004	1.00
32_A	133_R	1.001	1.00
67_D	70_E	0.990	1.00
20_K	23_D	0.989	1.00
69_R	74_I	0.980	1.00
117_S	120_D	0.976	1.00
27_A	158_W	0.976	1.00
86_L	161_I	0.963	1.00
18_E	103_T	0.949	1.00
16_V	108_Y	0.949	1.00
37_V	58_L	0.934	1.00
28_I	161_I	0.925	1.00
12_E	109_A	0.919	1.00
13_A	110_E	0.909	1.00
87_D	94_K	0.906	1.00
19_F	35_S	0.902	1.00
163_K	166_G	0.890	1.00
97_L	161_I	0.887	1.00
17_V	36_I	0.883	1.00
160_D	163_K	0.882	1.00
81_D	100_A	0.878	1.00
68_P	97_L	0.866	1.00
13_A	107_G	0.850	0.99
88_R	91_D	0.850	0.99
42_V	65_I	0.849	0.99
39_S	82_N	0.848	0.99
21_L	68_P	0.847	0.99
30_I	37_V	0.833	0.99
69_R	75_H	0.829	0.99
19_F	28_I	0.825	0.99
51_A	71_F	0.825	0.99
140_A	154_A	0.785	0.99
20_K	106_S	0.772	0.99
38_E	155_L	0.771	0.99
45_V	55_V	0.765	0.99
55_V	157_L	0.762	0.99
100_A	105_V	0.758	0.99
84_L	99_V	0.742	0.99
91_D	162_D	0.742	0.99
83_I	98_R	0.728	0.98
166_G	169_S	0.727	0.98
13_A	109_A	0.724	0.98
120_D	126_A	0.717	0.98
37_V	102_V	0.717	0.98
12_E	111_H	0.715	0.98
14_A	133_R	0.715	0.98
106_S	154_A	0.713	0.98
32_A	161_I	0.708	0.98
28_I	33_V	0.704	0.98
10_V	91_D	0.703	0.98
52_V	66_V	0.703	0.98
73_A	129_S	0.700	0.98
37_V	40_K	0.698	0.98
43_T	57_D	0.698	0.98
165_I	169_S	0.697	0.98
18_E	104_E	0.687	0.98
19_F	72_L	0.685	0.98
27_A	136_I	0.683	0.98
42_V	85_V	0.682	0.98
42_V	58_L	0.681	0.98
37_V	61_E	0.680	0.98
53_E	76_G	0.677	0.97
37_V	104_E	0.665	0.97
15_H	30_I	0.664	0.97
163_K	167_S	0.657	0.97
116_G	132_V	0.656	0.97
42_V	56_M	0.651	0.97
30_I	105_V	0.644	0.97
92_K	111_H	0.643	0.97
17_V	38_E	0.643	0.97
137_R	155_L	0.643	0.97
135_V	155_L	0.643	0.97
27_A	156_V	0.634	0.96
45_V	119_L	0.632	0.96
39_S	81_D	0.632	0.96
62_T	155_L	0.630	0.96
35_S	102_V	0.628	0.96
12_E	50_D	0.622	0.96
77_D	100_A	0.620	0.96
11_E	109_A	0.615	0.96
41_Q	88_R	0.615	0.96
28_I	88_R	0.613	0.95
55_V	135_V	0.612	0.95
31_A	34_D	0.610	0.95
112_Q	136_I	0.610	0.95
56_M	65_I	0.609	0.95
63_T	94_K	0.608	0.95
54_G	159_L	0.601	0.95
17_V	135_V	0.601	0.95
69_R	76_G	0.600	0.95
26_C	72_L	0.595	0.95
71_F	131_L	0.595	0.95
45_V	48_A	0.594	0.95
32_A	160_D	0.591	0.94
37_V	56_M	0.584	0.94
43_T	62_T	0.583	0.94
18_E	27_A	0.581	0.94
38_E	135_V	0.579	0.94
69_R	98_R	0.573	0.94
56_M	105_V	0.572	0.93
129_S	163_K	0.571	0.93
75_H	78_H	0.570	0.93
165_I	170_A	0.563	0.93
10_V	13_A	0.562	0.93
82_N	135_V	0.561	0.93
16_V	27_A	0.561	0.93
42_V	83_I	0.559	0.93
16_V	110_E	0.558	0.93
71_F	117_S	0.558	0.93
56_M	85_V	0.556	0.92
30_I	66_V	0.553	0.92
93_Q	165_I	0.551	0.92
20_K	25_V	0.550	0.92
88_R	159_L	0.547	0.92
18_E	156_V	0.547	0.92
21_L	74_I	0.545	0.92
48_A	51_A	0.544	0.92
108_Y	113_I	0.543	0.92
43_T	60_G	0.543	0.92
43_T	155_L	0.541	0.91
86_L	164_L	0.541	0.91
134_G	157_L	0.540	0.91
99_V	155_L	0.538	0.91
62_T	157_L	0.538	0.91
18_E	102_V	0.537	0.91
28_I	97_L	0.537	0.91
134_G	158_W	0.537	0.91
112_Q	137_R	0.532	0.91
15_H	37_V	0.529	0.91
21_L	39_S	0.525	0.90
166_G	170_A	0.522	0.90
67_D	77_D	0.522	0.90
36_I	45_V	0.520	0.90
45_V	114_D	0.519	0.90
21_L	69_R	0.518	0.90
51_A	70_E	0.517	0.90
38_E	105_V	0.516	0.89
55_V	102_V	0.514	0.89
74_I	77_D	0.514	0.89
10_V	140_A	0.514	0.89
107_G	110_E	0.513	0.89
23_D	77_D	0.512	0.89
94_K	140_A	0.510	0.89
37_V	137_R	0.506	0.89
52_V	64_A	0.506	0.89
82_N	104_E	0.502	0.88
83_I	114_D	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ho9A	1	0.8933	100	0.266	Contact Map
2qdlA	1	0.8596	100	0.279	Contact Map
4jpbW	1	0.7753	99.9	0.305	Contact Map
1b3qA	2	0.7697	99.4	0.615	Contact Map
4o0aA	1	0.6348	4.7	0.939	Contact Map
1wi9A	1	0.3933	4.4	0.94	Contact Map
2xheA	1	0.2809	4.1	0.941	Contact Map
1epuA	1	0.3258	4.1	0.941	Contact Map
4jehA	2	0.3596	3.1	0.944	Contact Map
4ccaA	1	0.3371	2.5	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.