Q9HQU5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQU5 - Uncharacterized protein

UniProt:	Q9HQU5	Sequences: MADSRYRSAVKAASYRVFATTLVFTIAFLYTGEFGSAAKIGVSAAVGKTVLYYLWERLWSTISWGRQAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	69 (64)
Sequences:	187 (137)
Seq/√Len:	17.2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_F	41_G	4.556	1.00
22_L	47_G	2.708	0.97
29_L	46_V	2.308	0.93
38_A	41_G	2.260	0.93
5_R	53_Y	2.228	0.92
46_V	50_V	1.954	0.86
8_S	37_A	1.907	0.84
19_A	22_L	1.796	0.80
27_A	40_I	1.785	0.80
20_T	41_G	1.751	0.79
5_R	60_S	1.588	0.71
3_D	60_S	1.560	0.70
9_A	28_F	1.553	0.70
8_S	60_S	1.507	0.67
14_S	37_A	1.487	0.66
12_A	49_T	1.477	0.65
12_A	44_A	1.442	0.64
10_V	42_V	1.377	0.60
52_Y	55_W	1.362	0.59
53_Y	63_S	1.327	0.57
39_K	43_S	1.246	0.52
24_F	44_A	1.223	0.51
54_L	58_L	1.171	0.48
28_F	32_G	1.100	0.43
6_Y	14_S	1.100	0.43
33_E	61_T	1.092	0.43
60_S	65_G	1.091	0.43
3_D	7_R	1.043	0.40
41_G	64_W	1.033	0.40
5_R	12_A	1.030	0.39
36_S	39_K	1.022	0.39
19_A	47_G	0.999	0.38
18_F	21_T	0.992	0.37
60_S	66_R	0.975	0.36
6_Y	61_T	0.970	0.36
33_E	36_S	0.958	0.35
19_A	40_I	0.953	0.35
30_Y	36_S	0.952	0.35
25_T	29_L	0.927	0.34
20_T	24_F	0.922	0.33
15_Y	47_G	0.902	0.32
22_L	51_L	0.880	0.31
27_A	47_G	0.869	0.31
20_T	52_Y	0.861	0.30
37_A	60_S	0.849	0.30
9_A	52_Y	0.828	0.29
44_A	55_W	0.824	0.28
5_R	64_W	0.822	0.28
20_T	32_G	0.810	0.28
24_F	38_A	0.803	0.27
5_R	57_R	0.799	0.27
36_S	49_T	0.779	0.26
3_D	54_L	0.770	0.26
31_T	40_I	0.768	0.26
4_S	54_L	0.759	0.25
20_T	55_W	0.742	0.25
20_T	30_Y	0.738	0.24
13_A	49_T	0.704	0.23
17_V	25_T	0.703	0.23
7_R	65_G	0.692	0.22
60_S	63_S	0.684	0.22
7_R	12_A	0.683	0.22
62_I	65_G	0.674	0.22
63_S	66_R	0.668	0.21
9_A	61_T	0.660	0.21
24_F	64_W	0.653	0.21
24_F	53_Y	0.652	0.21
18_F	33_E	0.648	0.21
18_F	62_I	0.648	0.21
28_F	38_A	0.646	0.20
50_V	63_S	0.641	0.20
13_A	44_A	0.628	0.20
19_A	34_F	0.618	0.19
30_Y	45_A	0.607	0.19
5_R	65_G	0.607	0.19
19_A	51_L	0.604	0.19
23_V	55_W	0.599	0.19
44_A	47_G	0.593	0.18
22_L	40_I	0.587	0.18
15_Y	22_L	0.585	0.18
4_S	39_K	0.577	0.18
20_T	53_Y	0.572	0.18
9_A	36_S	0.572	0.18
22_L	45_A	0.568	0.18
26_I	30_Y	0.562	0.17
44_A	53_Y	0.561	0.17
3_D	62_I	0.546	0.17
26_I	45_A	0.541	0.17
29_L	50_V	0.541	0.17
28_F	37_A	0.535	0.16
26_I	43_S	0.534	0.16
15_Y	45_A	0.528	0.16
22_L	44_A	0.518	0.16
58_L	61_T	0.517	0.16
42_V	57_R	0.510	0.16
25_T	50_V	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yikA	1	0.4203	7.6	0.921	Contact Map
1ia6A	1	0.4638	5.2	0.927	Contact Map
3wc3A	1	0.4638	4.1	0.931	Contact Map
2bt9A	3	0.5217	3.5	0.933	Contact Map
1g87A	2	0.4638	3.3	0.933	Contact Map
2mdtA	1	0.5072	3.1	0.935	Contact Map
1tf4A	1	0.4783	3.1	0.935	Contact Map
4i43B	1	0.8696	2.6	0.937	Contact Map
1ks8A	1	0.4638	2.4	0.938	Contact Map
1pp9J	1	0.7681	1.8	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.