Q9HQS7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQS7 - Uncharacterized protein

UniProt:	Q9HQS7	Sequences: MTPTTHTDATRALTVRREFIAQHYLTVPNPGPEGEVHSHRFTADVTFAGGELDEHGYLVDIDAVDAVLDDIEARYQDTLLNDHAEFGDANPSLERFAELIGDRIADGLGAAAPTRLTVRLWEDDLAWASHERALE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	135 (118)
Sequences:	2812 (1710)
Seq/√Len:	157.4

ECOLI - QUED
BACSU - QUED
HALSA - Q9HQS7 Q9HHN6
SULSO - Q97W30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_I	40_R	3.264	1.00
49_G	58_L	3.045	1.00
119_R	129_S	2.701	1.00
117_T	131_E	2.602	1.00
98_E	102_D	2.526	1.00
74_R	103_R	2.525	1.00
16_R	42_T	2.518	1.00
14_T	46_T	2.385	1.00
16_R	44_D	2.284	1.00
24_Y	79_L	2.274	1.00
12_A	48_A	2.272	1.00
117_T	129_S	2.200	1.00
44_D	119_R	2.198	1.00
48_A	116_L	2.088	1.00
75_Y	99_L	2.014	1.00
36_V	79_L	1.853	1.00
14_T	127_W	1.804	1.00
43_A	120_L	1.786	1.00
47_F	64_V	1.722	1.00
45_V	68_L	1.719	1.00
35_E	78_T	1.667	1.00
44_D	121_W	1.656	1.00
105_A	132_R	1.602	1.00
46_T	117_T	1.584	1.00
45_V	104_I	1.564	1.00
70_D	107_G	1.543	1.00
75_Y	100_I	1.533	1.00
12_A	46_T	1.516	1.00
19_F	43_A	1.481	1.00
69_D	73_A	1.476	1.00
32_P	62_D	1.454	1.00
98_E	130_H	1.452	1.00
101_G	130_H	1.411	1.00
97_A	118_V	1.403	1.00
99_L	103_R	1.399	1.00
101_G	132_R	1.397	1.00
95_R	98_E	1.377	1.00
28_P	31_G	1.371	1.00
12_A	116_L	1.345	1.00
22_Q	79_L	1.313	1.00
11_R	98_E	1.293	1.00
17_R	68_L	1.271	1.00
14_T	119_R	1.250	1.00
81_N	91_P	1.220	1.00
47_F	59_V	1.207	1.00
26_T	34_G	1.187	1.00
12_A	129_S	1.154	1.00
14_T	44_D	1.134	1.00
119_R	127_W	1.133	1.00
40_R	124_D	1.083	0.99
103_R	106_D	1.068	0.99
56_G	95_R	1.017	0.99
17_R	65_D	1.010	0.99
33_E	77_D	1.006	0.99
84_A	87_G	1.005	0.99
60_D	63_A	1.002	0.99
41_F	93_L	1.000	0.99
18_E	125_L	1.000	0.99
85_E	89_A	0.984	0.99
21_A	80_L	0.984	0.99
70_D	73_A	0.973	0.99
17_R	72_E	0.963	0.99
17_R	69_D	0.954	0.99
68_L	72_E	0.954	0.99
21_A	41_F	0.949	0.99
97_A	128_A	0.946	0.98
15_V	125_L	0.918	0.98
62_D	65_D	0.916	0.98
42_T	124_D	0.901	0.98
46_T	119_R	0.897	0.98
46_T	116_L	0.885	0.98
18_E	124_D	0.877	0.97
75_Y	96_F	0.875	0.97
42_T	121_W	0.873	0.97
74_R	85_E	0.862	0.97
18_E	40_R	0.860	0.97
116_L	131_E	0.858	0.97
52_L	55_H	0.854	0.97
102_D	132_R	0.852	0.97
18_E	42_T	0.850	0.97
12_A	131_E	0.847	0.97
33_E	122_E	0.840	0.97
71_I	100_I	0.839	0.97
15_V	126_A	0.836	0.97
14_T	129_S	0.827	0.96
11_R	51_E	0.825	0.96
121_W	127_W	0.809	0.96
67_V	70_D	0.807	0.96
50_G	114_T	0.797	0.96
66_A	70_D	0.796	0.96
12_A	117_T	0.796	0.96
63_A	66_A	0.786	0.95
41_F	120_L	0.760	0.94
105_A	109_G	0.754	0.94
29_N	34_G	0.746	0.94
28_P	57_Y	0.738	0.93
57_Y	92_S	0.735	0.93
34_G	92_S	0.728	0.93
100_I	118_V	0.726	0.93
61_I	65_D	0.725	0.93
59_V	63_A	0.721	0.93
67_V	107_G	0.715	0.92
24_Y	34_G	0.711	0.92
75_Y	85_E	0.706	0.92
40_R	121_W	0.700	0.91
23_H	94_E	0.686	0.91
101_G	118_V	0.677	0.90
48_A	114_T	0.671	0.90
27_V	55_H	0.668	0.89
25_L	90_N	0.668	0.89
102_D	105_A	0.667	0.89
100_I	120_L	0.665	0.89
120_L	128_A	0.659	0.89
13_L	64_V	0.656	0.89
15_V	123_D	0.655	0.89
22_Q	38_S	0.646	0.88
62_D	66_A	0.643	0.88
61_I	126_A	0.641	0.87
24_Y	36_V	0.635	0.87
11_R	130_H	0.633	0.87
53_D	107_G	0.629	0.86
96_F	100_I	0.626	0.86
31_G	34_G	0.623	0.86
106_D	115_R	0.622	0.86
25_L	31_G	0.619	0.86
20_I	124_D	0.616	0.85
43_A	68_L	0.616	0.85
71_I	74_R	0.615	0.85
26_T	90_N	0.613	0.85
74_R	78_T	0.612	0.85
107_G	110_A	0.611	0.85
74_R	83_H	0.605	0.84
97_A	120_L	0.604	0.84
15_V	68_L	0.602	0.84
22_Q	36_V	0.601	0.84
78_T	83_H	0.600	0.84
75_Y	103_R	0.596	0.83
67_V	108_L	0.594	0.83
90_N	93_L	0.592	0.83
21_A	81_N	0.591	0.83
19_F	120_L	0.590	0.83
108_L	115_R	0.588	0.83
27_V	54_E	0.585	0.82
106_D	109_G	0.585	0.82
98_E	101_G	0.584	0.82
16_R	124_D	0.582	0.82
93_L	96_F	0.580	0.82
65_D	69_D	0.579	0.82
48_A	115_R	0.578	0.82
33_E	93_L	0.578	0.82
100_I	104_I	0.578	0.82
37_H	122_E	0.565	0.80
79_L	82_D	0.560	0.79
88_D	114_T	0.559	0.79
11_R	52_L	0.558	0.79
93_L	124_D	0.555	0.79
109_G	114_T	0.553	0.79
99_L	102_D	0.550	0.78
40_R	125_L	0.549	0.78
43_A	75_Y	0.548	0.78
64_V	108_L	0.543	0.77
101_G	115_R	0.543	0.77
27_V	34_G	0.539	0.77
93_L	128_A	0.539	0.77
78_T	82_D	0.539	0.77
16_R	125_L	0.539	0.77
23_H	122_E	0.530	0.76
51_E	98_E	0.530	0.76
67_V	104_I	0.527	0.75
41_F	126_A	0.526	0.75
45_V	118_V	0.514	0.73
93_L	122_E	0.513	0.73
59_V	104_I	0.513	0.73
43_A	100_I	0.513	0.73
31_G	57_Y	0.512	0.73
63_A	67_V	0.504	0.72
32_P	73_A	0.500	0.71

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3d7jA	4	0.9481	100	0.133	Contact Map
1b66A	4	0.9259	100	0.164	Contact Map
2obaA	4	0.8889	100	0.167	Contact Map
2g64A	4	0.9481	100	0.171	Contact Map
4ntkA	4	0.8889	100	0.173	Contact Map
3jygA	4	0.9111	100	0.207	Contact Map
1y13A	5	0.9185	100	0.208	Contact Map
3lx3A	4	0.9185	100	0.208	Contact Map
2dj6A	3	0.8519	100	0.233	Contact Map
2kebA	1	0.4148	14.6	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.