Q9HQS5 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQS5 - Uncharacterized protein

UniProt:	Q9HQS5	Sequences: MMVLTHIAVGFLLAAPVAAAQPALGVPAAAGALVGGGAPDIDLLVGTHRRTLHYPVLGWVGAVPAAVIAAVTPTALTVFVGVGAAAAAVHSTSDVLGAGDELRPWERTTTAAVYDHHAGRWWRARYVIPYDGSPADLAVAAAAAAPALVVYDGVVRWLLAALLALGAVYSLLRRRLVPYFERVV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	184 (179)
Sequences:	115 (97)
Seq/√Len:	7.2

HALSA - Q9HQS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
129_P	135_A	4.672	0.99
4_L	166_G	3.984	0.96
115_D	118_A	3.718	0.94
58_G	91_S	3.333	0.90
73_P	77_T	3.034	0.85
172_L	177_V	2.695	0.77
10_G	99_G	2.525	0.72
92_T	96_L	2.459	0.70
57_L	117_H	2.351	0.66
63_V	80_V	2.263	0.63
95_V	122_W	2.154	0.59
96_L	127_V	2.080	0.57
137_L	170_S	1.938	0.51
27_P	31_G	1.924	0.50
115_D	174_R	1.915	0.50
62_A	150_V	1.889	0.49
129_P	133_S	1.852	0.48
29_A	151_Y	1.812	0.46
32_A	151_Y	1.811	0.46
9_V	143_A	1.798	0.46
81_G	165_L	1.778	0.45
38_A	83_G	1.768	0.44
44_L	180_F	1.748	0.44
20_A	125_R	1.670	0.41
119_G	158_L	1.656	0.40
127_V	150_V	1.632	0.39
44_L	100_D	1.595	0.38
110_T	170_S	1.589	0.38
75_A	150_V	1.573	0.37
45_V	177_V	1.570	0.37
98_A	126_Y	1.558	0.37
44_L	102_L	1.533	0.36
29_A	138_A	1.447	0.33
160_A	164_A	1.435	0.32
96_L	163_L	1.431	0.32
77_T	125_R	1.427	0.32
72_T	83_G	1.426	0.32
34_V	123_R	1.410	0.31
7_I	100_D	1.405	0.31
16_P	176_L	1.402	0.31
112_A	174_R	1.396	0.31
13_L	145_A	1.390	0.31
60_V	128_I	1.369	0.30
28_A	103_R	1.369	0.30
70_A	78_V	1.366	0.30
31_G	57_L	1.363	0.30
54_Y	83_G	1.355	0.30
7_I	37_G	1.341	0.29
141_A	163_L	1.318	0.28
34_V	60_V	1.314	0.28
46_G	101_E	1.309	0.28
50_R	166_G	1.300	0.28
96_L	122_W	1.295	0.28
22_P	69_A	1.269	0.27
65_A	168_V	1.268	0.27
83_G	143_A	1.261	0.27
31_G	117_H	1.259	0.27
32_A	147_A	1.243	0.26
43_L	101_E	1.234	0.26
2_M	6_H	1.224	0.25
2_M	5_T	1.224	0.25
106_E	174_R	1.223	0.25
11_F	23_A	1.220	0.25
14_A	103_R	1.210	0.25
109_T	124_A	1.201	0.25
59_W	63_V	1.180	0.24
31_G	50_R	1.170	0.24
15_A	32_A	1.159	0.24
33_L	88_A	1.153	0.23
55_P	116_H	1.147	0.23
98_A	107_R	1.128	0.23
7_I	57_L	1.127	0.23
46_G	102_L	1.124	0.23
163_L	179_Y	1.124	0.23
68_I	128_I	1.099	0.22
9_V	89_V	1.079	0.21
32_A	88_A	1.079	0.21
100_D	126_Y	1.071	0.21
33_L	61_G	1.061	0.21
61_G	148_L	1.057	0.21
154_V	160_A	1.055	0.21
15_A	164_A	1.051	0.21
41_I	128_I	1.039	0.20
46_G	107_R	1.039	0.20
66_A	176_L	1.030	0.20
64_P	163_L	1.029	0.20
91_S	96_L	1.025	0.20
15_A	33_L	1.020	0.20
107_R	177_V	1.018	0.20
91_S	133_S	1.016	0.20
26_V	85_A	1.012	0.20
76_L	152_D	1.008	0.20
75_A	122_W	0.995	0.19
44_L	107_R	0.994	0.19
89_V	149_V	0.993	0.19
29_A	147_A	0.990	0.19
85_A	156_R	0.986	0.19
85_A	148_L	0.985	0.19
100_D	117_H	0.985	0.19
43_L	133_S	0.980	0.19
131_D	169_Y	0.980	0.19
30_A	141_A	0.979	0.19
31_G	82_V	0.968	0.19
4_L	93_S	0.965	0.19
27_P	58_G	0.964	0.19
20_A	128_I	0.960	0.18
80_V	106_E	0.958	0.18
34_V	155_V	0.948	0.18
91_S	166_G	0.945	0.18
78_V	166_G	0.931	0.18
83_G	124_A	0.929	0.18
17_V	37_G	0.922	0.18
107_R	126_Y	0.922	0.18
100_D	107_R	0.917	0.17
99_G	112_A	0.914	0.17
33_L	50_R	0.905	0.17
14_A	78_V	0.899	0.17
15_A	31_G	0.891	0.17
50_R	56_V	0.878	0.17
126_Y	140_A	0.875	0.17
44_L	117_H	0.873	0.17
32_A	36_G	0.870	0.16
143_A	170_S	0.863	0.16
50_R	57_L	0.862	0.16
120_R	161_A	0.857	0.16
54_Y	147_A	0.852	0.16
70_A	152_D	0.848	0.16
99_G	109_T	0.843	0.16
73_P	165_L	0.836	0.16
102_L	109_T	0.835	0.16
152_D	164_A	0.835	0.16
91_S	135_A	0.834	0.16
41_I	68_I	0.834	0.16
66_A	142_A	0.833	0.16
103_R	106_E	0.827	0.16
125_R	149_V	0.825	0.15
126_Y	166_G	0.824	0.15
22_P	131_D	0.822	0.15
3_V	115_D	0.821	0.15
14_A	137_L	0.815	0.15
57_L	91_S	0.814	0.15
25_G	156_R	0.809	0.15
18_A	144_A	0.803	0.15
8_A	32_A	0.797	0.15
93_S	96_L	0.796	0.15
3_V	86_A	0.793	0.15
24_L	150_V	0.792	0.15
50_R	150_V	0.789	0.15
145_A	167_A	0.788	0.15
177_V	180_F	0.787	0.15
86_A	140_A	0.785	0.15
138_A	156_R	0.777	0.15
99_G	152_D	0.773	0.14
142_A	155_V	0.767	0.14
1_M	122_W	0.758	0.14
28_A	58_G	0.755	0.14
58_G	123_R	0.754	0.14
31_G	88_A	0.754	0.14
97_G	101_E	0.751	0.14
125_R	144_A	0.748	0.14
69_A	146_P	0.747	0.14
41_I	165_L	0.746	0.14
162_L	176_L	0.743	0.14
140_A	143_A	0.742	0.14
37_G	149_V	0.739	0.14
127_V	148_L	0.726	0.14
7_I	78_V	0.725	0.14
36_G	93_S	0.721	0.13
63_V	177_V	0.719	0.13
92_T	122_W	0.718	0.13
4_L	135_A	0.716	0.13
41_I	60_V	0.713	0.13
32_A	103_R	0.708	0.13
38_A	79_F	0.708	0.13
137_L	140_A	0.705	0.13
54_Y	168_V	0.705	0.13
91_S	147_A	0.704	0.13
38_A	58_G	0.696	0.13
29_A	54_Y	0.688	0.13
96_L	154_V	0.687	0.13
72_T	159_L	0.683	0.13
117_H	175_R	0.680	0.13
67_V	76_L	0.679	0.13
7_I	111_A	0.677	0.13
45_V	75_A	0.674	0.13
3_V	147_A	0.674	0.13
128_I	155_V	0.674	0.13
91_S	123_R	0.668	0.13
34_V	108_T	0.667	0.13
23_A	168_V	0.665	0.12
140_A	166_G	0.665	0.12
133_S	141_A	0.663	0.12
118_A	142_A	0.662	0.12
44_L	98_A	0.662	0.12
57_L	61_G	0.656	0.12
96_L	106_E	0.655	0.12
7_I	17_V	0.655	0.12
50_R	59_W	0.652	0.12
68_I	81_G	0.650	0.12
35_G	136_D	0.647	0.12
8_A	100_D	0.645	0.12
108_T	171_L	0.644	0.12
43_L	80_V	0.643	0.12
158_L	167_A	0.643	0.12
86_A	96_L	0.640	0.12
32_A	99_G	0.640	0.12
30_A	68_I	0.634	0.12
77_T	155_V	0.626	0.12
106_E	166_G	0.625	0.12
11_F	32_A	0.624	0.12
111_A	159_L	0.621	0.12
45_V	128_I	0.619	0.12
57_L	84_A	0.618	0.12
25_G	128_I	0.617	0.12
98_A	110_T	0.614	0.12
120_R	138_A	0.612	0.12
8_A	144_A	0.612	0.12
18_A	119_G	0.610	0.12
89_V	138_A	0.606	0.12
127_V	140_A	0.606	0.12
4_L	91_S	0.606	0.12
14_A	52_L	0.602	0.11
24_L	160_A	0.602	0.11
30_A	61_G	0.598	0.11
59_W	149_V	0.594	0.11
31_G	162_L	0.592	0.11
167_A	170_S	0.589	0.11
68_I	157_W	0.587	0.11
98_A	124_A	0.579	0.11
8_A	176_L	0.575	0.11
9_V	86_A	0.575	0.11
68_I	80_V	0.574	0.11
18_A	71_V	0.572	0.11
26_V	165_L	0.572	0.11
18_A	171_L	0.568	0.11
7_I	61_G	0.568	0.11
25_G	85_A	0.564	0.11
17_V	144_A	0.559	0.11
5_T	10_G	0.555	0.11
6_H	10_G	0.555	0.11
27_P	79_F	0.555	0.11
60_V	161_A	0.555	0.11
147_A	151_Y	0.554	0.11
95_V	140_A	0.544	0.11
109_T	159_L	0.540	0.11
4_L	162_L	0.539	0.11
59_W	85_A	0.539	0.11
15_A	68_I	0.536	0.10
103_R	137_L	0.536	0.10
16_P	103_R	0.526	0.10
91_S	179_Y	0.525	0.10
166_G	171_L	0.523	0.10
12_L	43_L	0.519	0.10
76_L	167_A	0.517	0.10
80_V	110_T	0.516	0.10
96_L	172_L	0.516	0.10
9_V	161_A	0.514	0.10
73_P	80_V	0.511	0.10
64_P	112_A	0.510	0.10
14_A	117_H	0.510	0.10
103_R	175_R	0.509	0.10
139_V	158_L	0.509	0.10
172_L	176_L	0.507	0.10
17_V	70_A	0.504	0.10
7_I	30_A	0.504	0.10
36_G	56_V	0.502	0.10
3_V	174_R	0.501	0.10
72_T	165_L	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yvpA	2	0.3696	5.5	0.971	Contact Map
1wazA	1	0.2337	2.6	0.975	Contact Map
4u7uA	1	0.375	2.5	0.975	Contact Map
2ysbA	1	0.1902	2.4	0.975	Contact Map
3ewtE	1	0.0652	2.3	0.976	Contact Map
2m7xA	1	0.163	1.9	0.977	Contact Map
2mdwA	2	0.1196	1.9	0.977	Contact Map
1pq1B	1	0.1576	1.8	0.977	Contact Map
1wr3A	1	0.1576	1.5	0.978	Contact Map
3ckjA	2	0.3043	1.2	0.98	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.