TPIS - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TPIS - Triosephosphate isomerase

UniProt:	Q9HQS4	Sequences: MFVLVNLKAYPCDPVAIAEAAADVAETTPATIAVAPQPADIGRVADTGATTYAQHVSPTEHGSHTGSVLAESVADNGAVGTLLNHSEHRRRLADIDGSVAAAERAGLDTVVCANNPAQVAAAAALGPDAVAVEPPALIGTGTPVSQADPDIVSDAVAAAEAVDPSVDVYCGAGITTGEDVVSAGDLGASGVLLASGVAKADDPRAALADLVAPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	214 (209)
Sequences:	301 (222)
Seq/√Len:	15.3

HALSA - TPIS
SULSO - TPIS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_S	88_H	4.402	1.00
4_L	110_V	4.390	1.00
81_T	109_T	3.913	1.00
73_V	78_A	3.656	1.00
163_D	166_V	3.653	1.00
102_A	109_T	3.472	0.99
37_Q	40_D	3.382	0.99
126_G	163_D	3.142	0.99
202_D	205_A	3.080	0.98
113_A	119_V	3.042	0.98
42_G	46_D	2.852	0.97
207_L	211_V	2.604	0.95
140_T	146_Q	2.589	0.95
160_E	168_V	2.549	0.95
63_S	170_C	2.421	0.93
37_Q	72_S	2.399	0.93
131_A	192_L	2.383	0.92
81_T	102_A	2.380	0.92
83_L	95_I	2.266	0.90
140_T	175_T	2.244	0.90
206_A	209_D	2.227	0.89
142_T	147_A	2.192	0.89
56_V	81_T	2.168	0.88
71_E	101_A	2.129	0.87
91_R	94_D	2.109	0.87
41_I	53_A	2.036	0.85
36_P	41_I	2.021	0.84
141_G	175_T	1.990	0.83
101_A	105_A	1.978	0.83
5_V	207_L	1.972	0.83
140_T	143_P	1.962	0.82
119_V	155_A	1.914	0.81
141_G	146_Q	1.807	0.77
130_V	166_V	1.778	0.75
45_A	78_A	1.767	0.75
70_A	101_A	1.738	0.74
15_V	44_V	1.691	0.72
143_P	147_A	1.661	0.70
38_P	68_V	1.617	0.68
141_G	174_I	1.603	0.67
146_Q	178_E	1.571	0.66
132_V	170_C	1.567	0.66
28_T	208_A	1.545	0.64
204_R	208_A	1.521	0.63
58_P	94_D	1.512	0.63
152_V	182_S	1.477	0.61
15_V	19_E	1.407	0.57
131_A	169_Y	1.404	0.57
119_V	159_A	1.390	0.56
143_P	146_Q	1.385	0.56
41_I	78_A	1.331	0.53
141_G	145_S	1.293	0.50
140_T	174_I	1.285	0.50
75_D	106_G	1.282	0.50
37_Q	69_L	1.268	0.49
93_A	115_N	1.260	0.49
89_R	93_A	1.259	0.49
5_V	9_A	1.255	0.48
89_R	113_A	1.241	0.48
134_P	190_G	1.236	0.47
41_I	76_N	1.236	0.47
7_L	14_P	1.234	0.47
31_T	50_T	1.220	0.46
149_P	186_L	1.213	0.46
103_E	128_D	1.200	0.45
82_L	131_A	1.188	0.45
34_V	68_V	1.187	0.44
126_G	165_S	1.178	0.44
59_T	69_L	1.168	0.43
170_C	188_A	1.164	0.43
193_L	207_L	1.159	0.43
182_S	185_D	1.156	0.43
186_L	190_G	1.134	0.42
3_V	207_L	1.130	0.41
56_V	69_L	1.121	0.41
19_E	101_A	1.111	0.40
15_V	47_T	1.084	0.39
83_L	125_L	1.078	0.38
109_T	140_T	1.072	0.38
33_A	52_Y	1.041	0.37
55_H	134_P	1.031	0.36
175_T	196_G	1.027	0.36
15_V	43_R	1.014	0.35
143_P	174_I	1.010	0.35
177_G	209_D	1.008	0.35
132_V	151_I	1.001	0.34
123_A	162_V	0.999	0.34
96_D	162_V	0.983	0.34
96_D	181_V	0.974	0.33
86_S	131_A	0.951	0.32
63_S	196_G	0.945	0.32
18_A	47_T	0.944	0.32
92_L	122_A	0.943	0.32
73_V	109_T	0.943	0.32
88_H	211_V	0.942	0.31
23_D	204_R	0.940	0.31
73_V	107_L	0.938	0.31
31_T	185_D	0.934	0.31
5_V	21_A	0.931	0.31
93_A	114_N	0.929	0.31
60_E	104_R	0.918	0.30
3_V	191_V	0.911	0.30
193_L	211_V	0.911	0.30
181_V	185_D	0.908	0.30
33_A	80_G	0.908	0.30
21_A	32_I	0.908	0.30
9_A	72_S	0.906	0.30
96_D	126_G	0.893	0.29
112_C	138_I	0.888	0.29
135_P	149_P	0.883	0.29
64_H	69_L	0.883	0.29
9_A	181_V	0.882	0.29
86_S	194_A	0.880	0.29
9_A	37_Q	0.879	0.28
135_P	171_G	0.878	0.28
103_E	164_P	0.877	0.28
145_S	174_I	0.873	0.28
3_V	147_A	0.872	0.28
60_E	69_L	0.869	0.28
24_V	89_R	0.867	0.28
49_A	126_G	0.866	0.28
125_L	211_V	0.863	0.28
51_T	57_S	0.862	0.28
89_R	95_I	0.862	0.28
68_V	119_V	0.861	0.28
56_V	73_V	0.859	0.28
75_D	158_A	0.859	0.28
94_D	165_S	0.857	0.27
100_A	117_A	0.852	0.27
152_V	183_A	0.838	0.27
15_V	18_A	0.834	0.26
3_V	209_D	0.834	0.26
61_H	69_L	0.830	0.26
135_P	194_A	0.828	0.26
35_A	41_I	0.826	0.26
143_P	182_S	0.826	0.26
71_E	157_A	0.826	0.26
98_S	159_A	0.820	0.26
157_A	161_A	0.811	0.25
146_Q	174_I	0.806	0.25
80_G	135_P	0.798	0.25
96_D	118_Q	0.794	0.25
12_C	75_D	0.792	0.25
123_A	169_Y	0.789	0.24
65_T	86_S	0.788	0.24
131_A	193_L	0.779	0.24
61_H	68_V	0.777	0.24
65_T	149_P	0.776	0.24
24_V	32_I	0.776	0.24
132_V	183_A	0.774	0.24
19_E	126_G	0.773	0.24
37_Q	184_G	0.771	0.24
123_A	166_V	0.768	0.24
12_C	109_T	0.763	0.23
201_D	204_R	0.763	0.23
106_G	202_D	0.762	0.23
70_A	105_A	0.761	0.23
114_N	121_A	0.758	0.23
30_A	56_V	0.754	0.23
86_S	89_R	0.753	0.23
155_A	188_A	0.749	0.23
108_D	128_D	0.747	0.23
40_D	119_V	0.744	0.23
86_S	135_P	0.743	0.23
99_V	111_V	0.742	0.23
43_R	209_D	0.735	0.22
60_E	100_A	0.735	0.22
45_A	102_A	0.735	0.22
198_A	202_D	0.734	0.22
144_V	151_I	0.734	0.22
203_P	207_L	0.733	0.22
206_A	211_V	0.728	0.22
99_V	201_D	0.726	0.22
118_Q	122_A	0.726	0.22
27_T	208_A	0.723	0.22
55_H	90_R	0.722	0.22
92_L	121_A	0.719	0.22
55_H	88_H	0.719	0.22
47_T	90_R	0.713	0.21
60_E	99_V	0.711	0.21
111_V	122_A	0.709	0.21
112_C	192_L	0.707	0.21
77_G	164_P	0.705	0.21
152_V	206_A	0.704	0.21
5_V	83_L	0.697	0.21
5_V	193_L	0.695	0.21
137_L	172_A	0.692	0.21
23_D	26_E	0.690	0.21
65_T	144_V	0.690	0.21
34_V	98_S	0.689	0.21
12_C	99_V	0.689	0.21
121_A	168_V	0.687	0.20
12_C	159_A	0.687	0.20
188_A	200_A	0.685	0.20
140_T	176_T	0.683	0.20
65_T	134_P	0.678	0.20
124_A	188_A	0.672	0.20
24_V	28_T	0.672	0.20
146_Q	175_T	0.669	0.20
140_T	151_I	0.666	0.20
57_S	88_H	0.666	0.20
140_T	145_S	0.662	0.20
154_D	157_A	0.661	0.20
147_A	191_V	0.661	0.20
16_A	19_E	0.660	0.19
147_A	203_P	0.660	0.19
126_G	157_A	0.659	0.19
17_I	20_A	0.659	0.19
98_S	208_A	0.658	0.19
134_P	186_L	0.656	0.19
97_G	100_A	0.655	0.19
47_T	179_D	0.653	0.19
159_A	174_I	0.651	0.19
47_T	50_T	0.649	0.19
24_V	104_R	0.649	0.19
16_A	44_V	0.648	0.19
99_V	109_T	0.648	0.19
7_L	47_T	0.647	0.19
128_D	175_T	0.646	0.19
31_T	37_Q	0.645	0.19
68_V	83_L	0.645	0.19
7_L	18_A	0.644	0.19
34_V	81_T	0.641	0.19
126_G	181_V	0.638	0.19
4_L	169_Y	0.637	0.19
13_D	207_L	0.633	0.19
13_D	16_A	0.632	0.19
41_I	198_A	0.632	0.19
65_T	135_P	0.627	0.18
145_S	178_E	0.626	0.18
146_Q	196_G	0.626	0.18
155_A	168_V	0.625	0.18
147_A	156_V	0.621	0.18
28_T	32_I	0.618	0.18
44_V	51_T	0.616	0.18
116_P	154_D	0.616	0.18
113_A	118_Q	0.616	0.18
9_A	206_A	0.613	0.18
185_D	207_L	0.611	0.18
17_I	207_L	0.608	0.18
22_A	48_G	0.608	0.18
5_V	209_D	0.607	0.18
121_A	124_A	0.606	0.18
7_L	102_A	0.605	0.18
101_A	104_R	0.603	0.18
44_V	74_A	0.594	0.17
15_V	179_D	0.594	0.17
75_D	97_G	0.593	0.17
38_P	202_D	0.591	0.17
14_P	50_T	0.590	0.17
80_G	149_P	0.588	0.17
137_L	190_G	0.586	0.17
29_P	186_L	0.584	0.17
93_A	97_G	0.584	0.17
41_I	91_R	0.583	0.17
20_A	209_D	0.583	0.17
57_S	169_Y	0.583	0.17
53_A	76_N	0.581	0.17
16_A	160_E	0.580	0.17
156_V	193_L	0.579	0.17
116_P	158_A	0.578	0.17
196_G	206_A	0.578	0.17
122_A	166_V	0.577	0.17
6_N	190_G	0.577	0.17
159_A	181_V	0.576	0.17
30_A	165_S	0.568	0.16
152_V	204_R	0.568	0.16
36_P	152_V	0.561	0.16
38_P	67_S	0.559	0.16
36_P	65_T	0.559	0.16
97_G	101_A	0.559	0.16
143_P	206_A	0.556	0.16
134_P	144_V	0.554	0.16
74_A	153_S	0.554	0.16
5_V	198_A	0.550	0.16
64_H	191_V	0.550	0.16
80_G	89_R	0.550	0.16
65_T	192_L	0.549	0.16
149_P	171_G	0.546	0.16
80_G	171_G	0.544	0.16
40_D	69_L	0.544	0.16
56_V	102_A	0.543	0.16
106_G	176_T	0.543	0.16
65_T	82_L	0.542	0.16
52_Y	80_G	0.542	0.16
116_P	129_A	0.540	0.16
158_A	161_A	0.540	0.16
13_D	101_A	0.537	0.15
64_H	115_N	0.536	0.15
62_G	84_N	0.536	0.15
134_P	137_L	0.532	0.15
160_E	185_D	0.531	0.15
134_P	139_G	0.529	0.15
171_G	193_L	0.527	0.15
149_P	194_A	0.527	0.15
14_P	17_I	0.527	0.15
56_V	82_L	0.524	0.15
99_V	122_A	0.517	0.15
76_N	88_H	0.516	0.15
60_E	64_H	0.516	0.15
82_L	112_C	0.515	0.15
36_P	53_A	0.513	0.15
7_L	17_I	0.513	0.15
6_N	186_L	0.512	0.15
152_V	168_V	0.512	0.15
170_C	183_A	0.508	0.15
23_D	205_A	0.508	0.15
40_D	78_A	0.507	0.15
55_H	172_A	0.506	0.15
73_V	114_N	0.505	0.15
156_V	200_A	0.504	0.15
93_A	118_Q	0.503	0.14
38_P	189_S	0.502	0.14
35_A	135_P	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4y9aA	2	0.972	100	0.505	Contact Map
4y96A	2	0.972	100	0.508	Contact Map
4y90A	3	0.972	100	0.515	Contact Map
4y8fA	2	0.9626	100	0.515	Contact Map
2h6rA	3	0.9579	100	0.522	Contact Map
4g1kA	2	0.972	100	0.545	Contact Map
2jgqA	2	0.9533	100	0.56	Contact Map
4mknA	2	0.986	100	0.562	Contact Map
4mvaA	2	0.9813	100	0.563	Contact Map
4nvtA	2	0.972	100	0.563	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.