Q9HQS3 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQS3 - Uncharacterized protein

UniProt:	Q9HQS3	Sequences: MAQCEMCGTEVSSPKTVKVEGAEIDVCDDCAEFGTEVTTQSSSSTSTKYSTSSSSSQSAGSSGGSSGTNSGGRRRRDMFDEMDELAGDYDTRIRSAREQAGLSQEELADELNEKASVIRKLEHGDSLPSDDVREELEDYLGILLTESGAEDASDTDWSSGGDSAGLTLGDKVRRKSDDS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (156)
Sequences:	223 (178)
Seq/√Len:	14.2

HALSA - Q9HQS3 Q9HPT1
SULSO - Q980M2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_Q	10_E	3.105	0.98
113_E	135_E	3.008	0.97
22_A	112_N	2.627	0.94
112_N	119_R	2.533	0.93
85_L	145_T	2.348	0.90
97_R	122_E	2.340	0.90
93_I	121_L	2.206	0.87
105_E	115_A	2.148	0.86
38_T	143_L	2.076	0.83
94_R	128_P	2.061	0.83
102_L	168_L	2.054	0.83
90_D	124_G	2.049	0.83
113_E	118_I	2.035	0.82
22_A	91_T	2.004	0.81
115_A	119_R	1.974	0.80
9_T	29_D	1.904	0.78
10_E	86_A	1.859	0.76
17_V	26_V	1.859	0.76
120_K	125_D	1.858	0.76
120_K	130_D	1.784	0.73
70_S	92_R	1.765	0.72
83_D	145_T	1.710	0.69
15_K	28_D	1.612	0.65
81_E	118_I	1.593	0.64
130_D	133_R	1.586	0.63
26_V	136_L	1.585	0.63
17_V	131_D	1.564	0.62
77_D	80_D	1.552	0.62
100_A	134_E	1.536	0.61
19_V	173_R	1.529	0.60
42_S	50_S	1.511	0.59
104_Q	118_I	1.508	0.59
85_L	165_G	1.491	0.58
6_M	22_A	1.471	0.57
102_L	106_E	1.470	0.57
104_Q	108_A	1.446	0.56
129_S	132_V	1.437	0.55
117_V	120_K	1.408	0.54
6_M	21_G	1.389	0.53
102_L	142_I	1.386	0.53
9_T	131_D	1.369	0.52
19_V	24_I	1.346	0.51
6_M	49_Y	1.343	0.50
94_R	98_E	1.316	0.49
93_I	103_S	1.315	0.49
34_G	135_E	1.315	0.49
111_L	129_S	1.299	0.48
100_A	139_Y	1.297	0.48
85_L	133_R	1.292	0.48
141_G	166_L	1.289	0.47
43_S	50_S	1.283	0.47
93_I	128_P	1.282	0.47
11_V	14_P	1.271	0.46
6_M	33_F	1.271	0.46
117_V	166_L	1.261	0.46
72_G	160_G	1.247	0.45
104_Q	112_N	1.238	0.45
16_T	25_D	1.230	0.44
117_V	126_S	1.218	0.44
20_E	89_Y	1.218	0.44
134_E	145_T	1.210	0.43
97_R	140_L	1.205	0.43
122_E	140_L	1.205	0.43
85_L	134_E	1.203	0.43
108_A	122_E	1.192	0.42
97_R	108_A	1.192	0.42
133_R	145_T	1.173	0.41
103_S	123_H	1.172	0.41
6_M	18_K	1.154	0.40
120_K	129_S	1.151	0.40
89_Y	136_L	1.140	0.39
85_L	161_G	1.136	0.39
107_L	140_L	1.127	0.39
121_L	132_V	1.124	0.39
129_S	133_R	1.113	0.38
117_V	129_S	1.108	0.38
20_E	129_S	1.104	0.38
161_G	164_A	1.102	0.37
22_A	171_K	1.098	0.37
38_T	105_E	1.084	0.37
76_R	84_E	1.079	0.36
120_K	133_R	1.073	0.36
63_G	121_L	1.052	0.35
125_D	140_L	1.049	0.35
42_S	49_Y	1.045	0.35
79_F	82_M	1.045	0.35
20_E	23_E	1.044	0.35
16_T	95_S	1.044	0.35
107_L	136_L	1.044	0.35
62_S	65_S	1.041	0.34
6_M	150_E	1.034	0.34
24_I	89_Y	1.027	0.34
12_S	99_Q	1.026	0.34
64_G	93_I	1.024	0.34
131_D	146_E	1.019	0.33
95_S	106_E	1.017	0.33
28_D	75_R	1.009	0.33
26_V	166_L	0.996	0.32
104_Q	115_A	0.984	0.32
73_R	142_I	0.980	0.31
151_D	156_D	0.971	0.31
120_K	123_H	0.970	0.31
86_A	92_R	0.967	0.31
20_E	114_K	0.961	0.31
11_V	28_D	0.931	0.29
15_K	26_V	0.913	0.28
113_E	132_V	0.908	0.28
17_V	95_S	0.899	0.28
77_D	120_K	0.886	0.27
6_M	164_A	0.883	0.27
159_S	165_G	0.881	0.27
35_T	142_I	0.868	0.26
36_E	113_E	0.858	0.26
108_A	111_L	0.850	0.26
98_E	123_H	0.847	0.26
108_A	140_L	0.846	0.25
85_L	126_S	0.845	0.25
85_L	130_D	0.829	0.25
41_S	99_Q	0.820	0.24
17_V	89_Y	0.819	0.24
32_E	131_D	0.810	0.24
68_T	73_R	0.791	0.23
69_N	111_L	0.790	0.23
105_E	109_D	0.790	0.23
74_R	132_V	0.789	0.23
111_L	135_E	0.789	0.23
91_T	156_D	0.788	0.23
94_R	141_G	0.783	0.23
46_S	49_Y	0.783	0.23
134_E	139_Y	0.782	0.23
85_L	157_W	0.781	0.23
14_P	84_E	0.779	0.23
39_T	147_S	0.777	0.23
83_D	133_R	0.776	0.23
26_V	157_W	0.759	0.22
29_D	110_E	0.749	0.22
167_T	170_D	0.745	0.22
41_S	139_Y	0.740	0.21
99_Q	139_Y	0.738	0.21
39_T	143_L	0.737	0.21
62_S	95_S	0.736	0.21
24_I	132_V	0.734	0.21
151_D	163_S	0.727	0.21
73_R	141_G	0.724	0.21
125_D	129_S	0.722	0.21
111_L	146_E	0.721	0.21
168_L	173_R	0.720	0.21
90_D	172_V	0.709	0.20
17_V	150_E	0.709	0.20
23_E	47_T	0.708	0.20
159_S	166_L	0.706	0.20
140_L	166_L	0.701	0.20
109_D	142_I	0.697	0.20
107_L	144_L	0.685	0.19
92_R	110_E	0.683	0.19
7_C	27_C	0.677	0.19
8_G	27_C	0.677	0.19
8_G	30_C	0.677	0.19
7_C	30_C	0.677	0.19
27_C	30_C	0.677	0.19
130_D	145_T	0.674	0.19
10_E	115_A	0.669	0.19
31_A	115_A	0.667	0.19
28_D	88_D	0.667	0.19
23_E	92_R	0.664	0.19
12_S	141_G	0.664	0.19
92_R	142_I	0.663	0.19
5_E	137_E	0.662	0.19
6_M	17_V	0.658	0.18
156_D	166_L	0.657	0.18
49_Y	142_I	0.646	0.18
138_D	141_G	0.644	0.18
112_N	127_L	0.643	0.18
24_I	90_D	0.641	0.18
110_E	148_G	0.635	0.18
45_T	48_K	0.631	0.18
101_G	125_D	0.630	0.18
16_T	98_E	0.628	0.18
86_A	151_D	0.623	0.17
128_P	167_T	0.622	0.17
29_D	48_K	0.620	0.17
132_V	168_L	0.616	0.17
19_V	95_S	0.615	0.17
148_G	163_S	0.614	0.17
69_N	73_R	0.610	0.17
83_D	90_D	0.604	0.17
36_E	93_I	0.596	0.17
18_K	39_T	0.595	0.16
13_S	81_E	0.594	0.16
11_V	81_E	0.594	0.16
74_R	113_E	0.594	0.16
43_S	46_S	0.594	0.16
25_D	142_I	0.590	0.16
10_E	148_G	0.587	0.16
3_Q	120_K	0.581	0.16
3_Q	114_K	0.579	0.16
26_V	31_A	0.577	0.16
75_R	148_G	0.576	0.16
47_T	94_R	0.574	0.16
156_D	165_G	0.572	0.16
50_S	121_L	0.571	0.16
11_V	171_K	0.569	0.16
135_E	138_D	0.568	0.16
81_E	124_G	0.564	0.16
84_E	130_D	0.560	0.15
112_N	129_S	0.558	0.15
121_L	136_L	0.554	0.15
161_G	172_V	0.553	0.15
158_S	161_G	0.553	0.15
105_E	114_K	0.553	0.15
10_E	95_S	0.548	0.15
63_G	67_G	0.544	0.15
74_R	80_D	0.543	0.15
20_E	104_Q	0.537	0.15
14_P	172_V	0.537	0.15
3_Q	133_R	0.536	0.15
48_K	69_N	0.535	0.15
9_T	145_T	0.534	0.15
77_D	130_D	0.530	0.15
91_T	95_S	0.527	0.15
45_T	49_Y	0.526	0.15
119_R	128_P	0.524	0.14
68_T	78_M	0.517	0.14
150_E	166_L	0.517	0.14
127_L	133_R	0.515	0.14
66_S	69_N	0.513	0.14
40_Q	43_S	0.511	0.14
74_R	111_L	0.510	0.14
40_Q	118_I	0.505	0.14
94_R	119_R	0.505	0.14
26_V	45_T	0.504	0.14
23_E	28_D	0.504	0.14
150_E	163_S	0.500	0.14
20_E	36_E	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3o9xA	2	0.6648	99.4	0.742	Contact Map
2mezA	1	0.5475	99.2	0.767	Contact Map
2wusR	1	0.4525	98.6	0.812	Contact Map
1y9qA	1	0.5531	98.6	0.815	Contact Map
1x57A	1	0.5084	98.5	0.816	Contact Map
4gqmA	2	0.5531	98.5	0.817	Contact Map
3mlfA	2	0.5307	98.5	0.817	Contact Map
3fymA	1	0.4246	98.5	0.818	Contact Map
2jvlA	1	0.5866	98.5	0.818	Contact Map
3f52A	2	0.4469	98.4	0.822	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.