Q9HQS2 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQS2 - CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase

UniProt:	Q9HQS2	Sequences: MTLDQFRPLANRLLDPWVRAAKTVGATPNTVSVAAFGLAVVAAAAFYVGTPAAYAVGAVCVFFNGWLDLLDGALAREVGTASEAGDLLDHVLDRYADVVVVTGAAAGVDAFGLGLAAVTGVLLTSYLGTQAQAVGLDRVYGGLLGRADRLALVGVTAGVAAITPTVAGYSPVVALLVVFAVVGHLTAIQRFVSAWRQLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	199 (181)
Sequences:	2367 (1643)
Seq/√Len:	122.1

ECOLI - YNBA YNJF
HALSA - Q9HQS2
SULSO - Q7LXU6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_T	30_T	4.647	1.00
22_K	74_L	3.869	1.00
28_P	80_T	3.353	1.00
36_F	92_L	3.063	1.00
26_A	34_A	3.026	1.00
20_A	24_V	2.966	1.00
95_Y	184_H	2.675	1.00
39_A	96_A	2.663	1.00
18_V	77_E	2.633	1.00
156_T	175_L	2.541	1.00
84_A	195_W	2.349	1.00
21_A	26_A	2.274	1.00
45_A	60_C	2.208	1.00
73_A	77_E	2.041	1.00
31_V	74_L	2.027	1.00
105_A	114_G	1.915	1.00
43_A	103_G	1.907	1.00
46_F	157_A	1.906	1.00
186_T	190_R	1.873	1.00
40_V	99_V	1.806	1.00
86_D	130_Q	1.788	1.00
94_R	97_D	1.759	1.00
68_D	89_D	1.739	1.00
19_R	77_E	1.687	1.00
33_V	88_L	1.681	1.00
18_V	74_L	1.650	1.00
188_I	192_V	1.639	1.00
129_T	132_Q	1.638	1.00
192_V	195_W	1.565	1.00
142_G	148_D	1.559	1.00
120_G	184_H	1.559	1.00
155_V	159_V	1.539	1.00
22_K	78_V	1.527	1.00
46_F	103_G	1.519	1.00
131_A	135_G	1.516	1.00
43_A	99_V	1.487	1.00
29_N	84_A	1.479	1.00
117_A	180_A	1.454	1.00
35_A	67_L	1.448	1.00
94_R	146_R	1.434	1.00
20_A	23_T	1.424	1.00
21_A	70_L	1.417	1.00
95_Y	120_G	1.385	1.00
145_G	148_D	1.385	1.00
38_L	60_C	1.382	1.00
49_G	54_Y	1.378	1.00
47_Y	103_G	1.367	1.00
142_G	186_T	1.361	1.00
97_D	149_R	1.332	1.00
144_L	152_L	1.323	1.00
103_G	107_G	1.322	1.00
86_D	134_V	1.311	1.00
87_L	127_L	1.289	1.00
146_R	149_R	1.275	1.00
11_N	73_A	1.257	1.00
98_V	123_L	1.256	1.00
94_R	126_Y	1.254	1.00
105_A	115_L	1.244	0.99
144_L	182_V	1.244	0.99
41_V	60_C	1.225	0.99
98_V	119_T	1.215	0.99
170_S	174_A	1.212	0.99
124_T	186_T	1.196	0.99
129_T	133_A	1.195	0.99
39_A	64_N	1.193	0.99
90_H	130_Q	1.192	0.99
130_Q	133_A	1.189	0.99
179_F	183_G	1.179	0.99
18_V	73_A	1.175	0.99
44_A	48_V	1.154	0.99
97_D	146_R	1.151	0.99
37_G	41_V	1.151	0.99
178_V	182_V	1.139	0.99
128_G	138_R	1.136	0.99
113_L	177_V	1.129	0.99
27_T	74_L	1.123	0.99
70_L	73_A	1.096	0.99
33_V	37_G	1.085	0.99
87_L	194_A	1.072	0.98
32_S	92_L	1.070	0.98
98_V	122_L	1.068	0.98
46_F	107_G	1.055	0.98
16_P	20_A	1.044	0.98
19_R	23_T	1.042	0.98
91_V	127_L	1.039	0.98
120_G	187_A	1.036	0.98
7_R	18_V	1.036	0.98
47_Y	106_A	1.035	0.98
45_A	56_V	1.032	0.98
56_V	60_C	1.031	0.98
31_V	70_L	1.017	0.98
58_A	154_G	1.013	0.98
142_G	147_A	1.012	0.98
94_R	149_R	1.012	0.98
28_P	74_L	1.008	0.98
156_T	172_V	1.005	0.98
115_L	118_V	1.004	0.98
7_R	11_N	0.993	0.97
181_V	185_L	0.990	0.97
69_L	147_A	0.987	0.97
28_P	81_A	0.983	0.97
159_V	163_T	0.980	0.97
90_H	149_R	0.980	0.97
185_L	189_Q	0.969	0.97
90_H	128_G	0.968	0.97
17_W	70_L	0.963	0.97
14_L	73_A	0.963	0.97
146_R	150_L	0.952	0.97
168_G	171_P	0.943	0.96
46_F	57_G	0.937	0.96
34_A	38_L	0.928	0.96
12_R	16_P	0.925	0.96
144_L	179_F	0.924	0.96
16_P	19_R	0.924	0.96
44_A	47_Y	0.918	0.96
129_T	138_R	0.915	0.96
65_G	146_R	0.909	0.96
141_G	193_S	0.906	0.96
87_L	191_F	0.902	0.95
128_G	133_A	0.895	0.95
64_N	146_R	0.888	0.95
142_G	190_R	0.882	0.95
172_V	175_L	0.873	0.95
28_P	46_F	0.864	0.94
21_A	24_V	0.864	0.94
65_G	69_L	0.863	0.94
54_Y	107_G	0.863	0.94
185_L	188_I	0.857	0.94
114_G	176_L	0.857	0.94
118_V	121_V	0.855	0.94
148_D	151_A	0.855	0.94
180_A	184_H	0.851	0.94
124_T	187_A	0.848	0.94
147_A	151_A	0.845	0.94
116_A	119_T	0.842	0.93
55_A	59_V	0.841	0.93
128_G	132_Q	0.840	0.93
174_A	177_V	0.814	0.92
20_A	41_V	0.810	0.92
117_A	183_G	0.810	0.92
64_N	89_D	0.809	0.92
124_T	144_L	0.807	0.92
138_R	141_G	0.802	0.92
42_A	60_C	0.797	0.91
131_A	138_R	0.789	0.91
123_L	126_Y	0.782	0.91
127_L	191_F	0.780	0.91
8_P	12_R	0.778	0.90
33_V	192_V	0.777	0.90
15_D	77_E	0.774	0.90
38_L	67_L	0.774	0.90
89_D	146_R	0.760	0.89
143_L	148_D	0.756	0.89
38_L	64_N	0.756	0.89
114_G	117_A	0.755	0.89
11_N	18_V	0.747	0.89
132_Q	136_L	0.747	0.89
104_A	172_V	0.739	0.88
35_A	96_A	0.735	0.88
158_G	162_I	0.735	0.88
9_L	12_R	0.730	0.87
126_Y	130_Q	0.730	0.87
104_A	114_G	0.723	0.87
64_N	68_D	0.722	0.87
11_N	15_D	0.720	0.87
64_N	96_A	0.720	0.87
132_Q	138_R	0.718	0.87
186_T	189_Q	0.717	0.86
84_A	194_A	0.717	0.86
170_S	178_V	0.713	0.86
149_R	154_G	0.707	0.86
26_A	30_T	0.706	0.86
55_A	158_G	0.704	0.85
55_A	162_I	0.704	0.85
24_V	78_V	0.704	0.85
82_S	156_T	0.704	0.85
37_G	111_F	0.702	0.85
88_L	92_L	0.701	0.85
41_V	45_A	0.696	0.85
62_F	66_W	0.691	0.84
41_V	44_A	0.691	0.84
151_A	155_V	0.690	0.84
100_V	150_L	0.686	0.84
84_A	87_L	0.680	0.83
123_L	187_A	0.680	0.83
87_L	90_H	0.679	0.83
13_L	16_P	0.675	0.83
61_V	69_L	0.674	0.83
74_L	121_V	0.668	0.82
8_P	11_N	0.661	0.82
65_G	94_R	0.656	0.81
62_F	65_G	0.651	0.81
152_L	156_T	0.651	0.81
57_G	104_A	0.649	0.80
46_F	100_V	0.647	0.80
133_A	137_D	0.642	0.80
133_A	136_L	0.642	0.80
42_A	61_V	0.639	0.79
42_A	100_V	0.638	0.79
156_T	159_V	0.637	0.79
128_G	139_V	0.634	0.79
10_A	147_A	0.633	0.79
147_A	150_L	0.628	0.78
129_T	135_G	0.628	0.78
125_S	149_R	0.626	0.78
46_F	49_G	0.620	0.77
32_S	148_D	0.619	0.77
10_A	15_D	0.610	0.76
68_D	90_H	0.609	0.76
32_S	61_V	0.594	0.74
86_D	90_H	0.586	0.73
68_D	146_R	0.584	0.73
30_T	34_A	0.581	0.73
19_R	158_G	0.579	0.72
11_N	14_L	0.579	0.72
95_Y	187_A	0.578	0.72
133_A	138_R	0.578	0.72
49_G	107_G	0.577	0.72
65_G	154_G	0.577	0.72
45_A	181_V	0.575	0.72
90_H	94_R	0.575	0.72
58_A	158_G	0.573	0.72
87_L	131_A	0.571	0.71
126_Y	129_T	0.571	0.71
116_A	120_G	0.571	0.71
125_S	132_Q	0.570	0.71
87_L	134_V	0.570	0.71
90_H	129_T	0.569	0.71
142_G	149_R	0.562	0.70
150_L	154_G	0.561	0.70
65_G	150_L	0.560	0.70
76_R	89_D	0.560	0.70
122_L	136_L	0.558	0.70
14_L	18_V	0.556	0.69
33_V	178_V	0.552	0.69
173_V	177_V	0.551	0.69
97_D	148_D	0.551	0.69
176_L	179_F	0.550	0.69
107_G	114_G	0.548	0.68
180_A	183_G	0.548	0.68
29_N	80_T	0.546	0.68
57_G	157_A	0.544	0.68
29_N	192_V	0.541	0.67
7_R	189_Q	0.540	0.67
142_G	146_R	0.539	0.67
112_G	116_A	0.538	0.67
159_V	162_I	0.538	0.67
113_L	176_L	0.538	0.67
138_R	194_A	0.536	0.67
69_L	148_D	0.535	0.67
68_D	76_R	0.534	0.66
170_S	176_L	0.531	0.66
54_Y	57_G	0.531	0.66
30_T	83_E	0.531	0.66
117_A	126_Y	0.529	0.66
111_F	122_L	0.528	0.66
91_V	95_Y	0.525	0.65
64_N	90_H	0.524	0.65
90_H	97_D	0.523	0.65
82_S	141_G	0.518	0.64
89_D	143_L	0.518	0.64
32_S	69_L	0.512	0.63
184_H	187_A	0.510	0.63
41_V	106_A	0.510	0.63
62_F	69_L	0.509	0.63
152_L	179_F	0.508	0.63
131_A	194_A	0.506	0.62
105_A	118_V	0.506	0.62
10_A	58_A	0.505	0.62
37_G	63_F	0.502	0.62
27_T	80_T	0.501	0.62
17_W	37_G	0.500	0.61

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o6mA	2	0.9397	100	0.304	Contact Map
4mndA	2	0.9347	99.9	0.429	Contact Map
3wu2A	1	0.5528	5.5	0.949	Contact Map
4leuA	1	0.3467	4.7	0.951	Contact Map
4od4A	1	0.9045	3.7	0.953	Contact Map
4tq3A	1	0.9196	3.6	0.953	Contact Map
4me2A	1	0.4472	2.5	0.957	Contact Map
4wmuA	1	0.5427	2.3	0.958	Contact Map
3ilcA	1	0.5377	2.2	0.958	Contact Map
3tx3A	2	0.9347	2.1	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.