KAD6 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KAD6 - Putative adenylate kinase

UniProt:	Q9HQS1	Sequences: MRVAVTGTPGTGKTTATGRLDTALDVAHLNDLVGTEGLYDGVDADRGSKIVDVDAVRDHFAGREDVLVESHLAHRLDDLDAVVVLRCAPETLATRLQDRGDSPEKAAENADSEALAIILSEAVRGHGADAVYEIDTTDRSPDAVAAAIQAVLDGDREPSAGTVDYTDYV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	169 (151)
Sequences:	6021 (3529)
Seq/√Len:	287.2

ECOLI - KAD AROL AROK
BACSU - KAD AROK YQAC
HALSA - KAD6 KCY KAD Y2452
SULSO - KAD6 KCY Y1041

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_P	116_A	3.733	1.00
40_D	43_D	3.375	1.00
41_G	44_A	3.167	1.00
33_V	56_V	2.831	1.00
139_R	147_A	2.787	1.00
86_R	134_I	2.649	1.00
19_R	145_A	2.581	1.00
35_T	39_Y	2.561	1.00
113_E	117_I	2.459	1.00
41_G	45_D	2.399	1.00
127_G	134_I	2.267	1.00
57_R	71_H	2.248	1.00
84_V	134_I	2.209	1.00
106_A	109_N	2.118	1.00
36_E	62_G	2.107	1.00
91_T	94_T	2.100	1.00
139_R	143_A	2.048	1.00
42_V	45_D	2.036	1.00
85_L	137_T	1.955	1.00
88_A	138_D	1.872	1.00
81_A	133_E	1.818	1.00
114_A	118_I	1.805	1.00
40_D	44_A	1.797	1.00
145_A	149_Q	1.793	1.00
109_N	112_S	1.719	1.00
133_E	151_V	1.699	1.00
140_S	143_A	1.693	1.00
11_T	87_C	1.621	1.00
120_S	124_R	1.587	1.00
91_T	138_D	1.586	1.00
19_R	142_D	1.575	1.00
100_G	104_E	1.553	1.00
124_R	128_A	1.549	1.00
116_A	120_S	1.540	1.00
5_V	17_T	1.513	1.00
44_A	52_D	1.502	1.00
40_D	45_D	1.472	1.00
52_D	55_A	1.428	1.00
6_T	123_V	1.407	1.00
36_E	59_H	1.370	1.00
87_C	137_T	1.353	1.00
97_Q	110_A	1.353	1.00
85_L	148_I	1.328	1.00
16_A	148_I	1.323	1.00
36_E	39_Y	1.294	1.00
19_R	22_T	1.293	1.00
82_V	132_Y	1.293	1.00
146_A	150_A	1.276	1.00
98_D	101_D	1.274	1.00
84_V	123_V	1.270	1.00
143_A	147_A	1.236	1.00
105_K	108_E	1.230	1.00
4_A	79_L	1.221	1.00
10_G	96_L	1.174	1.00
124_R	127_G	1.173	1.00
100_G	103_P	1.141	1.00
139_R	144_V	1.138	1.00
8_T	115_L	1.132	1.00
98_D	102_S	1.123	1.00
58_D	61_A	1.116	1.00
18_G	22_T	1.102	1.00
53_V	74_H	1.090	1.00
89_P	113_E	1.088	1.00
146_A	149_Q	1.085	1.00
101_D	104_E	1.067	1.00
5_V	20_L	1.062	1.00
28_H	31_D	1.055	1.00
147_A	150_A	1.049	1.00
42_V	46_R	1.044	1.00
136_T	139_R	1.043	1.00
43_D	47_G	1.026	1.00
90_E	94_T	1.022	1.00
16_A	145_A	1.011	1.00
143_A	146_A	0.963	1.00
115_L	119_L	0.961	1.00
66_V	79_L	0.958	1.00
55_A	58_D	0.958	1.00
2_R	66_V	0.956	1.00
5_V	67_L	0.955	1.00
79_L	131_V	0.915	1.00
2_R	80_D	0.910	1.00
14_T	69_E	0.906	1.00
93_A	97_Q	0.905	1.00
8_T	92_L	0.895	1.00
21_D	26_V	0.893	1.00
6_T	82_V	0.889	1.00
78_D	125_G	0.889	1.00
97_Q	109_N	0.883	1.00
101_D	105_K	0.883	1.00
30_N	34_G	0.881	1.00
83_V	148_I	0.873	1.00
18_G	26_V	0.872	1.00
86_R	123_V	0.868	1.00
32_L	36_E	0.866	1.00
7_G	10_G	0.865	1.00
135_D	151_V	0.862	1.00
57_R	60_F	0.855	1.00
93_A	110_A	0.844	1.00
56_V	60_F	0.842	1.00
97_Q	100_G	0.841	1.00
20_L	148_I	0.841	1.00
24_L	66_V	0.840	1.00
24_L	65_D	0.834	1.00
32_L	59_H	0.833	1.00
135_D	144_V	0.833	1.00
3_V	81_A	0.829	1.00
125_G	129_D	0.813	1.00
136_T	144_V	0.810	0.99
25_D	65_D	0.810	0.99
18_G	21_D	0.810	0.99
119_L	123_V	0.809	0.99
37_G	45_D	0.808	0.99
5_V	85_L	0.807	0.99
2_R	79_L	0.804	0.99
138_D	144_V	0.791	0.99
136_T	147_A	0.790	0.99
104_E	109_N	0.786	0.99
20_L	67_L	0.781	0.99
17_T	26_V	0.780	0.99
30_N	73_A	0.777	0.99
12_G	15_T	0.771	0.99
97_Q	104_E	0.770	0.99
141_P	145_A	0.769	0.99
114_A	117_I	0.766	0.99
46_R	106_A	0.765	0.99
78_D	126_H	0.762	0.99
33_V	60_F	0.755	0.99
31_D	35_T	0.749	0.99
53_V	76_L	0.746	0.99
53_V	77_D	0.745	0.99
103_P	106_A	0.744	0.99
45_D	58_D	0.744	0.99
137_T	144_V	0.740	0.99
33_V	37_G	0.739	0.99
84_V	132_Y	0.733	0.99
7_G	11_T	0.726	0.99
21_D	25_D	0.725	0.99
74_H	77_D	0.722	0.99
40_D	58_D	0.713	0.99
12_G	95_R	0.711	0.99
9_P	112_S	0.704	0.99
23_A	64_E	0.704	0.99
72_L	77_D	0.700	0.99
54_D	58_D	0.697	0.98
75_R	125_G	0.692	0.98
97_Q	103_P	0.691	0.98
113_E	116_A	0.690	0.98
8_T	11_T	0.689	0.98
142_D	146_A	0.689	0.98
89_P	93_A	0.689	0.98
94_T	98_D	0.685	0.98
16_A	19_R	0.679	0.98
81_A	151_V	0.673	0.98
27_A	32_L	0.673	0.98
36_E	58_D	0.673	0.98
2_R	6_T	0.669	0.98
29_L	60_F	0.657	0.98
138_D	147_A	0.653	0.98
108_E	112_S	0.649	0.98
75_R	122_A	0.648	0.98
81_A	152_L	0.646	0.98
87_C	92_L	0.644	0.97
21_D	67_L	0.640	0.97
16_A	144_V	0.634	0.97
104_E	108_E	0.626	0.97
16_A	135_D	0.624	0.97
129_D	132_Y	0.621	0.97
88_A	91_T	0.621	0.97
82_V	131_V	0.621	0.97
5_V	83_V	0.620	0.97
122_A	126_H	0.618	0.97
137_T	141_P	0.614	0.97
35_T	38_L	0.609	0.96
2_R	24_L	0.606	0.96
51_V	56_V	0.605	0.96
104_E	110_A	0.602	0.96
16_A	141_P	0.601	0.96
49_K	52_D	0.601	0.96
148_I	151_V	0.598	0.96
6_T	84_V	0.598	0.96
57_R	61_A	0.595	0.96
90_E	93_A	0.586	0.96
115_L	126_H	0.584	0.96
33_V	36_E	0.584	0.96
9_P	92_L	0.578	0.95
119_L	122_A	0.576	0.95
43_D	46_R	0.575	0.95
103_P	107_A	0.571	0.95
25_D	63_R	0.570	0.95
123_V	132_Y	0.569	0.95
88_A	92_L	0.568	0.95
99_R	108_E	0.567	0.95
4_A	82_V	0.567	0.95
40_D	54_D	0.563	0.95
34_G	73_A	0.563	0.95
51_V	70_S	0.560	0.94
99_R	107_A	0.551	0.94
122_A	132_Y	0.550	0.94
14_T	99_R	0.548	0.94
142_D	145_A	0.545	0.94
15_T	69_E	0.540	0.93
87_C	95_R	0.539	0.93
25_D	32_L	0.537	0.93
71_H	76_L	0.532	0.93
86_R	136_T	0.527	0.92
29_L	32_L	0.527	0.92
18_G	103_P	0.521	0.92
83_V	133_E	0.519	0.92
25_D	66_V	0.517	0.92
50_I	56_V	0.516	0.92
94_T	97_Q	0.516	0.92
140_S	144_V	0.515	0.92
48_S	51_V	0.514	0.92
102_S	108_E	0.514	0.92
65_D	80_D	0.511	0.91
17_T	85_L	0.508	0.91
84_V	115_L	0.508	0.91
40_D	55_A	0.506	0.91
6_T	132_Y	0.506	0.91
115_L	122_A	0.506	0.91
19_R	141_P	0.505	0.91
30_N	99_R	0.503	0.91
3_V	152_L	0.502	0.91
39_Y	44_A	0.501	0.90
75_R	96_L	0.501	0.90
147_A	151_V	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qbgB	1	0.929	99.9	0.454	Contact Map
2xb4A	4	0.9053	99.9	0.467	Contact Map
4jzkA	1	0.9053	99.9	0.482	Contact Map
3tlxA	1	0.9112	99.9	0.484	Contact Map
4jl5A	1	0.9053	99.9	0.484	Contact Map
3gmtA	1	0.8047	99.9	0.485	Contact Map
1ukzA	1	0.9231	99.9	0.486	Contact Map
1akyA	1	0.9172	99.9	0.488	Contact Map
3be4A	1	0.8994	99.9	0.488	Contact Map
1zakA	2	0.9704	99.9	0.488	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.