Q9HQL7 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q9HQL7 - Uncharacterized protein

UniProt:	Q9HQL7	Sequences: MTERRAALVLVDFQQGFADPAWGDRNNPDAEAHAEELLAAWRDAAAPIAHVRHNSTEATSPLRQGEPGFAYTDGLAPAADEPEFVKSVNGAFVDTALEGWLRDRDTGSLVVCGLTTDHCVSTTVRMADNRGFDVTLVRDATATHDRTLDGERLPPSVVHRTALAHLRGEFATLATTATVLAGP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	183 (159)
Sequences:	10127 (7129)
Seq/√Len:	565.3

ECOLI - RUTB YECD PNCA YCAC
BACSU - YRDC YAAI YDDQ YWOC PNCA
HALSA - Q9HQL7 Q9HMH5
SULSO - Q97VZ5 Q97YW7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_E	102_R	3.441	1.00
52_R	85_V	2.929	1.00
108_S	133_D	2.735	1.00
98_E	132_F	2.714	1.00
41_W	46_A	2.683	1.00
90_G	126_M	2.662	1.00
34_A	112_C	2.512	1.00
6_A	108_S	2.479	1.00
98_E	130_R	2.345	1.00
108_S	135_T	2.319	1.00
16_G	68_G	2.304	1.00
37_L	137_V	2.258	1.00
13_F	34_A	2.257	1.00
111_V	124_V	2.238	1.00
121_S	125_R	2.052	1.00
5_R	107_G	2.023	1.00
96_A	100_W	1.980	1.00
84_F	100_W	1.920	1.00
127_A	134_V	1.905	1.00
7_A	106_T	1.875	1.00
91_A	123_T	1.855	1.00
33_H	140_A	1.838	1.00
15_Q	67_P	1.818	1.00
40_A	44_A	1.816	1.00
33_H	36_E	1.776	1.00
49_A	100_W	1.763	1.00
146_R	150_G	1.743	1.00
42_R	81_E	1.669	1.00
6_A	110_V	1.615	1.00
15_Q	73_D	1.542	1.00
10_L	38_L	1.531	1.00
26_N	29_D	1.521	1.00
67_P	70_A	1.518	1.00
110_V	137_V	1.514	1.00
154_P	157_V	1.502	1.00
41_W	110_V	1.501	1.00
18_A	72_T	1.499	1.00
156_S	161_T	1.494	1.00
51_V	91_A	1.482	1.00
82_P	100_W	1.459	1.00
109_L	127_A	1.434	1.00
47_P	104_R	1.433	1.00
120_V	136_L	1.420	1.00
117_D	143_T	1.405	1.00
10_L	112_C	1.403	1.00
64_Q	85_V	1.379	1.00
35_E	39_A	1.361	1.00
111_V	123_T	1.356	1.00
116_T	141_T	1.344	1.00
136_L	141_T	1.340	1.00
9_V	111_V	1.329	1.00
100_W	104_R	1.297	1.00
54_N	69_F	1.287	1.00
143_T	149_D	1.279	1.00
126_M	130_R	1.251	1.00
39_A	43_D	1.251	1.00
35_E	74_G	1.237	1.00
10_L	13_F	1.218	1.00
54_N	85_V	1.217	1.00
116_T	149_D	1.197	1.00
11_V	119_C	1.188	1.00
99_G	103_D	1.182	1.00
8_L	41_W	1.179	1.00
32_A	74_G	1.173	1.00
102_R	132_F	1.162	1.00
30_A	34_A	1.161	1.00
52_R	71_Y	1.157	1.00
121_S	155_P	1.126	1.00
33_H	139_D	1.106	1.00
15_Q	70_A	1.096	1.00
37_L	140_A	1.094	1.00
38_L	42_R	1.085	1.00
122_T	125_R	1.076	1.00
10_L	34_A	1.069	1.00
96_A	99_G	1.034	1.00
110_V	135_T	1.023	1.00
12_D	86_K	1.016	1.00
54_N	64_Q	1.016	1.00
52_R	83_E	1.003	1.00
156_S	160_R	0.990	1.00
109_L	134_V	0.984	1.00
71_Y	83_E	0.977	1.00
150_G	154_P	0.977	1.00
38_L	50_H	0.971	1.00
138_R	163_L	0.956	1.00
100_W	103_D	0.954	1.00
6_A	46_A	0.949	1.00
124_V	136_L	0.948	1.00
50_H	77_P	0.945	1.00
147_T	150_G	0.940	1.00
36_E	40_A	0.925	1.00
101_L	132_F	0.923	1.00
78_A	81_E	0.916	1.00
70_A	76_A	0.897	1.00
116_T	143_T	0.895	1.00
56_T	64_Q	0.894	1.00
116_T	153_L	0.894	1.00
7_A	49_A	0.889	1.00
30_A	142_A	0.886	1.00
40_A	43_D	0.880	1.00
112_C	140_A	0.870	1.00
35_E	77_P	0.867	1.00
92_F	127_A	0.863	1.00
13_F	114_L	0.860	1.00
50_H	71_Y	0.858	1.00
91_A	97_L	0.855	1.00
37_L	112_C	0.847	1.00
58_A	61_P	0.843	1.00
137_V	140_A	0.841	1.00
15_Q	19_D	0.841	1.00
59_T	63_R	0.834	1.00
31_E	35_E	0.826	1.00
88_V	131_G	0.823	1.00
107_G	133_D	0.821	1.00
77_P	81_E	0.818	1.00
36_E	39_A	0.817	1.00
93_V	130_R	0.816	1.00
154_P	158_V	0.811	1.00
7_A	101_L	0.804	1.00
9_V	97_L	0.799	1.00
17_F	119_C	0.798	1.00
47_P	106_T	0.793	1.00
124_V	156_S	0.786	1.00
49_A	104_R	0.780	1.00
32_A	36_E	0.775	1.00
138_R	153_L	0.770	1.00
47_P	100_W	0.763	1.00
38_L	48_I	0.747	1.00
11_V	111_V	0.746	1.00
111_V	134_V	0.744	1.00
30_A	114_L	0.739	1.00
88_V	94_D	0.731	1.00
15_Q	72_T	0.728	1.00
147_T	154_P	0.728	1.00
31_E	72_T	0.727	1.00
152_R	156_S	0.726	1.00
159_H	163_L	0.726	1.00
34_A	140_A	0.724	1.00
65_G	68_G	0.722	1.00
82_P	104_R	0.721	1.00
50_H	80_D	0.721	1.00
66_E	69_F	0.720	1.00
29_D	32_A	0.718	1.00
128_D	161_T	0.714	1.00
110_V	139_D	0.705	1.00
124_V	134_V	0.703	1.00
35_E	76_A	0.699	1.00
111_V	120_V	0.694	1.00
73_D	76_A	0.694	1.00
114_L	142_A	0.691	1.00
5_R	108_S	0.691	1.00
77_P	83_E	0.690	1.00
67_P	73_D	0.690	1.00
126_M	129_N	0.683	1.00
151_E	154_P	0.679	1.00
117_D	144_H	0.678	1.00
50_H	81_E	0.677	1.00
115_T	143_T	0.673	1.00
52_R	69_F	0.671	1.00
49_A	82_P	0.667	1.00
157_V	160_R	0.666	1.00
151_E	155_P	0.663	1.00
20_P	23_G	0.659	1.00
121_S	152_R	0.655	1.00
19_D	28_P	0.654	1.00
42_R	78_A	0.650	1.00
13_F	72_T	0.648	1.00
39_A	78_A	0.642	1.00
32_A	35_E	0.638	1.00
60_S	63_R	0.636	1.00
72_T	75_L	0.632	1.00
8_L	37_L	0.630	1.00
39_A	76_A	0.626	1.00
42_R	80_D	0.622	1.00
115_T	118_H	0.621	1.00
37_L	110_V	0.621	1.00
65_G	70_A	0.619	1.00
158_V	162_A	0.617	1.00
25_R	142_A	0.617	1.00
90_G	129_N	0.616	1.00
50_H	75_L	0.615	1.00
27_N	114_L	0.615	1.00
99_G	102_R	0.612	1.00
10_L	50_H	0.611	1.00
160_R	163_L	0.610	1.00
41_W	47_P	0.610	1.00
94_D	99_G	0.605	1.00
145_D	148_L	0.604	1.00
93_V	129_N	0.600	1.00
134_V	137_V	0.599	1.00
153_L	157_V	0.598	1.00
18_A	31_E	0.598	1.00
155_P	158_V	0.596	1.00
25_R	29_D	0.594	1.00
14_Q	52_R	0.593	1.00
38_L	41_W	0.587	1.00
89_N	123_T	0.586	1.00
38_L	81_E	0.585	1.00
89_N	118_H	0.585	1.00
101_L	106_T	0.580	1.00
42_R	50_H	0.579	1.00
31_E	74_G	0.577	1.00
17_F	115_T	0.574	1.00
148_L	151_E	0.571	0.99
93_V	126_M	0.571	0.99
115_T	144_H	0.568	0.99
5_R	105_D	0.566	0.99
112_C	137_V	0.564	0.99
71_Y	77_P	0.563	0.99
120_V	141_T	0.563	0.99
89_N	128_D	0.563	0.99
153_L	163_L	0.562	0.99
52_R	70_A	0.561	0.99
118_H	144_H	0.561	0.99
42_R	48_I	0.557	0.99
49_A	84_F	0.557	0.99
116_T	163_L	0.555	0.99
50_H	83_E	0.554	0.99
56_T	59_T	0.553	0.99
18_A	27_N	0.551	0.99
89_N	129_N	0.545	0.99
8_L	112_C	0.544	0.99
13_F	30_A	0.544	0.99
77_P	80_D	0.542	0.99
84_F	96_A	0.536	0.99
53_H	62_L	0.527	0.99
17_F	89_N	0.526	0.99
8_L	38_L	0.526	0.99
14_Q	51_V	0.524	0.99
56_T	87_S	0.522	0.99
29_D	33_H	0.518	0.99
13_F	75_L	0.517	0.99
47_P	82_P	0.513	0.99
19_D	67_P	0.509	0.99
159_H	162_A	0.508	0.99
28_P	74_G	0.507	0.99
135_T	162_A	0.501	0.99
128_D	134_V	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3oqpA	2	0.9945	100	0.17	Contact Map
3mcwA	2	0.9454	100	0.183	Contact Map
3lqyA	2	0.9781	100	0.188	Contact Map
3hb7A	3	0.9508	100	0.191	Contact Map
3irvA	2	0.9672	100	0.194	Contact Map
2fq1A	2	1	100	0.199	Contact Map
3hu5A	3	0.9454	100	0.202	Contact Map
1nbaA	4	0.9945	100	0.206	Contact Map
1nf9A	2	0.929	100	0.206	Contact Map
4l07A	4	0.9727	100	0.207	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.