Y1115 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y1115 - Probable S-adenosyl-L-methionine-binding protein VNG_1115H

UniProt:	Q9HQK7	Sequences: MYATPIGYADTRFETAADAPRQGVETPYAANVQVYESFRGGLVGLEPDDRVVVVWWADDADRDVLAVRDGDRGVFTTRSPARPNPVCITPCELLAVDAADGTLAIRGVDMAHGSPVLDLKPALD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (119)
Sequences:	1764 (1238)
Seq/√Len:	113.5

ECOLI - TSAA
HALSA - Y1115
SULSO - Q97U53

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
92_E	106_R	3.450	1.00
95_A	104_A	3.255	1.00
10_D	33_Q	2.607	1.00
31_N	102_T	2.607	1.00
45_L	96_V	2.447	1.00
94_L	106_R	2.316	1.00
10_D	112_H	2.201	1.00
19_A	111_A	2.173	1.00
72_R	77_T	2.126	1.00
54_V	86_V	2.073	1.00
93_L	103_L	2.032	1.00
32_V	53_V	1.991	1.00
45_L	51_V	1.945	1.00
32_V	105_I	1.930	1.00
56_W	117_L	1.910	1.00
14_E	112_H	1.868	1.00
52_V	90_P	1.853	1.00
3_A	56_W	1.814	1.00
11_T	30_A	1.764	1.00
105_I	108_V	1.749	1.00
9_A	116_V	1.727	1.00
33_Q	102_T	1.718	1.00
29_A	104_A	1.713	1.00
97_D	104_A	1.687	1.00
29_A	94_L	1.660	1.00
53_V	116_V	1.616	1.00
91_C	105_I	1.615	1.00
30_A	108_V	1.593	1.00
86_V	117_L	1.575	1.00
31_N	104_A	1.574	1.00
3_A	85_P	1.561	1.00
56_W	85_P	1.538	1.00
51_V	93_L	1.442	1.00
57_A	87_C	1.415	1.00
59_D	111_A	1.395	1.00
45_L	93_L	1.358	1.00
4_T	37_S	1.345	1.00
5_P	8_Y	1.320	1.00
8_Y	35_Y	1.293	0.99
52_V	88_I	1.282	0.99
10_D	31_N	1.276	0.99
53_V	91_C	1.273	0.99
55_W	87_C	1.253	0.99
7_G	34_V	1.236	0.99
54_V	117_L	1.232	0.99
94_L	104_A	1.187	0.99
34_V	119_L	1.169	0.99
39_R	99_A	1.156	0.99
39_R	98_A	1.136	0.99
54_V	88_I	1.130	0.99
29_A	106_R	1.122	0.98
68_R	71_D	1.114	0.98
3_A	117_L	1.082	0.98
44_G	72_R	1.062	0.98
87_C	114_S	1.036	0.97
6_I	41_G	1.034	0.97
110_M	116_V	1.011	0.97
11_T	110_M	1.003	0.97
97_D	102_T	0.991	0.97
36_E	39_R	0.982	0.97
74_V	79_S	0.957	0.96
55_W	110_M	0.946	0.96
51_V	91_C	0.940	0.96
55_W	89_T	0.932	0.95
12_R	28_Y	0.930	0.95
30_A	110_M	0.920	0.95
21_R	25_E	0.914	0.95
51_V	119_L	0.914	0.95
72_R	76_T	0.913	0.95
105_I	116_V	0.907	0.95
15_T	18_D	0.903	0.94
42_L	103_L	0.892	0.94
51_V	105_I	0.891	0.94
13_F	28_Y	0.889	0.94
67_V	77_T	0.887	0.94
43_V	66_A	0.876	0.93
9_A	30_A	0.872	0.93
58_D	111_A	0.870	0.93
48_D	93_L	0.867	0.93
96_V	103_L	0.859	0.93
50_R	122_A	0.841	0.92
50_R	90_P	0.839	0.92
11_T	108_V	0.833	0.92
42_L	98_A	0.832	0.92
60_A	63_D	0.825	0.91
53_V	119_L	0.825	0.91
53_V	110_M	0.822	0.91
62_R	85_P	0.821	0.91
93_L	96_V	0.816	0.91
41_G	65_L	0.807	0.90
52_V	122_A	0.802	0.90
99_A	102_T	0.783	0.89
42_L	93_L	0.771	0.88
32_V	116_V	0.767	0.88
50_R	92_E	0.767	0.88
38_F	75_F	0.751	0.87
45_L	103_L	0.751	0.87
3_A	86_V	0.748	0.87
103_L	119_L	0.745	0.86
13_F	19_A	0.744	0.86
67_V	114_S	0.738	0.86
77_T	80_P	0.737	0.86
7_G	35_Y	0.733	0.86
35_Y	38_F	0.723	0.85
57_A	114_S	0.720	0.85
64_V	81_A	0.718	0.84
66_A	71_D	0.718	0.84
33_Q	99_A	0.716	0.84
8_Y	33_Q	0.714	0.84
19_A	74_V	0.712	0.84
14_E	111_A	0.704	0.83
92_E	107_G	0.702	0.83
40_G	102_T	0.684	0.81
65_L	68_R	0.680	0.81
61_D	85_P	0.676	0.81
5_P	117_L	0.674	0.80
34_V	116_V	0.672	0.80
87_C	115_P	0.666	0.80
22_Q	78_R	0.660	0.79
44_G	77_T	0.658	0.79
9_A	108_V	0.644	0.77
55_W	90_P	0.638	0.77
89_T	114_S	0.632	0.76
32_V	103_L	0.628	0.76
30_A	91_C	0.622	0.75
15_T	111_A	0.622	0.75
3_A	63_D	0.616	0.74
42_L	45_L	0.615	0.74
41_G	74_V	0.614	0.74
69_D	87_C	0.612	0.74
10_D	113_G	0.612	0.74
61_D	65_L	0.611	0.74
89_T	109_D	0.610	0.74
19_A	58_D	0.608	0.73
20_P	78_R	0.602	0.73
9_A	53_V	0.600	0.72
42_L	119_L	0.599	0.72
49_D	122_A	0.596	0.72
41_G	75_F	0.595	0.72
16_A	19_A	0.594	0.72
74_V	77_T	0.594	0.72
28_Y	107_G	0.591	0.71
29_A	105_I	0.590	0.71
43_V	68_R	0.589	0.71
25_E	77_T	0.583	0.70
11_T	112_H	0.582	0.70
60_A	85_P	0.582	0.70
16_A	57_A	0.580	0.70
22_Q	25_E	0.580	0.70
13_F	22_Q	0.579	0.70
9_A	32_V	0.575	0.69
36_E	88_I	0.571	0.69
62_R	108_V	0.558	0.67
19_A	25_E	0.556	0.67
89_T	96_V	0.555	0.66
41_G	52_V	0.553	0.66
78_R	121_P	0.549	0.66
22_Q	77_T	0.545	0.65
63_D	81_A	0.541	0.64
27_P	106_R	0.540	0.64
31_N	97_D	0.539	0.64
52_V	81_A	0.535	0.64
31_N	95_A	0.532	0.63
57_A	79_S	0.530	0.63
58_D	115_P	0.530	0.63
62_R	67_V	0.529	0.63
47_P	72_R	0.526	0.62
110_M	114_S	0.526	0.62
52_V	89_T	0.525	0.62
65_L	81_A	0.523	0.62
16_A	22_Q	0.513	0.60
89_T	107_G	0.511	0.60
34_V	42_L	0.507	0.59
29_A	92_E	0.505	0.59
79_S	123_L	0.505	0.59
60_A	64_V	0.504	0.59
50_R	109_D	0.500	0.58
11_T	20_P	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nv4A	2	0.9839	100	0.075	Contact Map
3okxA	2	0.9839	100	0.089	Contact Map
1xqbA	2	0.8871	100	0.097	Contact Map
2fj6A	1	0.5403	8.6	0.951	Contact Map
4qpiA	5	0.3306	6.2	0.954	Contact Map
2kzkA	1	0.6371	6	0.954	Contact Map
2q9kA	2	0.3548	5.7	0.954	Contact Map
4d9iA	2	0.4032	5.2	0.955	Contact Map
1tmoA	1	0.8952	4.2	0.957	Contact Map
4g4sP	1	0.7419	4.1	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.