RS11 - HALSA - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS11 - 30S ribosomal protein S11

UniProt:	Q9HQJ5	Sequences: MADDTKWGIAHVHASFNNTIMTVTDQTGAETLAKSSGGSVVKQNRDEASPYAAMQMAEQLAEEVLDQGIEKVHVRVRGPGGNLQRSPGPGAQAAIRALARAGLEIGRIEDVTPIPHDGTRPPKNSGY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	127 (113)
Sequences:	1497 (605)
Seq/√Len:	56.9

ECOLI - RS11
BACSU - RS11
HALSA - RS11
SULSO - RS11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_T	31_T	3.742	1.00
9_I	75_R	3.645	1.00
8_G	69_I	3.562	1.00
25_D	29_A	3.497	1.00
72_V	103_L	3.218	1.00
35_S	59_Q	2.994	1.00
60_L	64_V	2.718	1.00
73_H	106_G	2.596	1.00
10_A	23_V	2.550	1.00
73_H	107_R	2.535	1.00
59_Q	63_E	2.368	1.00
61_A	101_A	2.343	1.00
35_S	39_S	2.217	1.00
71_K	104_E	2.182	1.00
10_A	72_V	2.163	1.00
7_W	71_K	2.060	1.00
32_L	67_Q	2.015	1.00
32_L	69_I	1.941	1.00
5_T	32_L	1.819	0.99
74_V	98_L	1.661	0.99
23_V	60_L	1.635	0.99
65_L	70_E	1.607	0.99
98_L	103_L	1.600	0.99
19_T	48_A	1.592	0.98
21_M	60_L	1.491	0.98
62_E	65_L	1.470	0.97
4_D	67_Q	1.427	0.97
75_R	111_V	1.364	0.96
12_V	94_A	1.353	0.96
33_A	60_L	1.337	0.95
23_V	64_V	1.331	0.95
10_A	98_L	1.330	0.95
16_F	79_P	1.307	0.95
57_A	61_A	1.302	0.95
39_S	59_Q	1.288	0.94
71_K	106_G	1.259	0.94
5_T	67_Q	1.205	0.92
35_S	40_V	1.198	0.92
11_H	111_V	1.156	0.90
62_E	66_D	1.148	0.90
11_H	24_T	1.104	0.88
6_K	31_T	1.095	0.88
39_S	63_E	1.089	0.88
20_I	36_S	1.076	0.87
40_V	59_Q	1.070	0.87
17_N	47_E	1.061	0.86
45_R	48_A	1.044	0.85
13_H	20_I	1.022	0.84
99_A	105_I	1.012	0.84
75_R	107_R	0.974	0.81
115_P	118_G	0.971	0.81
7_W	26_Q	0.968	0.81
76_V	95_I	0.940	0.79
53_A	90_G	0.939	0.79
50_P	89_P	0.937	0.79
61_A	72_V	0.928	0.78
26_Q	31_T	0.924	0.78
6_K	26_Q	0.916	0.77
42_K	46_D	0.915	0.77
64_V	67_Q	0.915	0.77
40_V	55_Q	0.913	0.77
23_V	98_L	0.895	0.75
95_I	104_E	0.885	0.74
4_D	69_I	0.883	0.74
13_H	89_P	0.847	0.71
90_G	112_T	0.839	0.70
15_S	89_P	0.838	0.70
12_V	95_I	0.833	0.70
42_K	125_S	0.818	0.68
25_D	100_R	0.783	0.65
62_E	75_R	0.774	0.64
91_A	110_D	0.773	0.64
16_F	48_A	0.773	0.64
23_V	103_L	0.765	0.63
37_G	40_V	0.759	0.63
9_I	26_Q	0.757	0.62
6_K	69_I	0.752	0.62
76_V	94_A	0.750	0.62
13_H	122_P	0.744	0.61
63_E	67_Q	0.739	0.61
51_Y	55_Q	0.736	0.60
75_R	109_E	0.730	0.60
46_D	116_H	0.723	0.59
92_Q	108_I	0.720	0.59
14_A	90_G	0.716	0.58
20_I	119_T	0.712	0.58
28_G	38_G	0.709	0.57
61_A	103_L	0.705	0.57
14_A	95_I	0.704	0.57
18_N	118_G	0.704	0.57
117_D	123_K	0.703	0.57
55_Q	58_E	0.701	0.57
41_V	46_D	0.690	0.55
13_H	109_E	0.683	0.55
12_V	111_V	0.682	0.54
17_N	125_S	0.682	0.54
14_A	55_Q	0.681	0.54
118_G	123_K	0.680	0.54
41_V	78_G	0.677	0.54
89_P	99_A	0.676	0.54
16_F	58_E	0.675	0.54
116_H	119_T	0.664	0.53
42_K	54_M	0.663	0.52
40_V	56_M	0.658	0.52
12_V	17_N	0.652	0.51
34_K	39_S	0.649	0.51
43_Q	58_E	0.647	0.51
13_H	125_S	0.645	0.50
12_V	55_Q	0.644	0.50
97_A	125_S	0.643	0.50
5_T	25_D	0.640	0.50
10_A	15_S	0.639	0.50
76_V	79_P	0.637	0.50
118_G	121_P	0.636	0.49
19_T	53_A	0.634	0.49
40_V	51_Y	0.630	0.49
47_E	107_R	0.629	0.49
14_A	50_P	0.629	0.49
37_G	52_A	0.629	0.49
7_W	27_T	0.628	0.49
61_A	98_L	0.626	0.48
69_I	94_A	0.620	0.48
47_E	76_V	0.619	0.48
67_Q	93_A	0.616	0.47
92_Q	96_R	0.613	0.47
71_K	93_A	0.605	0.46
11_H	75_R	0.604	0.46
34_K	37_G	0.597	0.45
42_K	112_T	0.592	0.45
38_G	116_H	0.589	0.44
20_I	57_A	0.588	0.44
72_V	98_L	0.586	0.44
22_T	106_G	0.581	0.43
48_A	56_M	0.580	0.43
54_M	91_A	0.579	0.43
14_A	96_R	0.564	0.42
51_Y	58_E	0.563	0.42
39_S	77_R	0.563	0.42
33_A	66_D	0.560	0.41
33_A	56_M	0.560	0.41
13_H	22_T	0.559	0.41
41_V	47_E	0.559	0.41
44_N	78_G	0.558	0.41
72_V	105_I	0.556	0.41
46_D	123_K	0.556	0.41
105_I	108_I	0.553	0.40
37_G	44_N	0.553	0.40
7_W	104_E	0.553	0.40
69_I	72_V	0.553	0.40
61_A	65_L	0.550	0.40
37_G	56_M	0.549	0.40
120_R	125_S	0.543	0.39
26_Q	73_H	0.540	0.39
57_A	101_A	0.539	0.39
15_S	66_D	0.535	0.39
22_T	28_G	0.535	0.39
105_I	109_E	0.534	0.39
39_S	93_A	0.534	0.39
4_D	64_V	0.525	0.38
36_S	40_V	0.524	0.37
60_L	72_V	0.523	0.37
60_L	67_Q	0.521	0.37
12_V	47_E	0.521	0.37
24_T	28_G	0.519	0.37
8_G	44_N	0.518	0.37
100_R	122_P	0.517	0.37
58_E	93_A	0.516	0.37
79_P	109_E	0.513	0.36
77_R	111_V	0.509	0.36
48_A	89_P	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cvnE	1	0.9685	100	0.117	Contact Map
3zeyH	1	0.9134	100	0.147	Contact Map
4ujpP	1	0.9606	100	0.148	Contact Map
3j7aP	1	0.9685	100	0.149	Contact Map
4tp8K	1	0.0157	100	0.161	Contact Map
4rb5K	1	0.8976	100	0.162	Contact Map
3bbnK	1	0.9291	100	0.163	Contact Map
5aj3K	1	0.9291	100	0.164	Contact Map
1ovyA	1	0.7559	96.1	0.873	Contact Map
4tp9O	1	0.0157	95.9	0.875	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.